Gene Information

Name : Cycma_1189 (Cycma_1189)
Accession : YP_004773192.1
Strain : Cyclobacterium marinum DSM 745
Genome accession: NC_015914
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1401774 - 1402472 bp
Length : 699 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cly:Celly_2950

DNA sequence :
ATGTGCGAAAAAAAGATACTGCTAATTGAGGACGATAAGGACATTGCTGAATTGGTAGCCTTGCACCTTAGCAACTTAGG
GTATGAGGTTGAGTGTGTCAATAACTTTACTGAAGGAATGAAACGTTCTCTTGAAAACCACTACCTGCTCATTTTATTGG
ACTTGATGCTCCCTGATGGAGACGGATTAGATATTTGCCACAAATTAAGAAGAGAGAAAATACAAACACCAATAGTAATG
CTCACTGCCAAGACTGAAGAAATCGATAAGGTCTTGGGCCTGGAATCAGGCGCAGACGATTACATTAGCAAACCTTTTAG
CATCAGAGAGTTTATTGCTAGAATAAAAGCAATAATTCGCCGTAGTGCTATATCCATTATTGAAAATGAGGAGGATATTT
TTCAGTTTGATGAATTGGTAATTAACATCTTTAAGCGCAAGGTAACTATTCATGACAACCCTATAGAATTAACAAAAAAA
GAATTTGAATTGCTTTATTTTTTAGCCAAAAACAAAGGCGTTACCTATTCGAGGGAAAAGCTGCTAAACATCATTTGGGG
TTATGAGTACAGTGGCTATGACCATACTGTAAATTCCCATATTAACCGCTTGCGTGCGAAAATCGAGCAAACTCCAAATA
AACCCAAATTCATTTTAACCTCTTGGGGTGTAGGTTATAAGTTCAATGATGAATTATAA

Protein sequence :
MCEKKILLIEDDKDIAELVALHLSNLGYEVECVNNFTEGMKRSLENHYLLILLDLMLPDGDGLDICHKLRREKIQTPIVM
LTAKTEEIDKVLGLESGADDYISKPFSIREFIARIKAIIRRSAISIIENEEDIFQFDELVINIFKRKVTIHDNPIELTKK
EFELLYFLAKNKGVTYSREKLLNIIWGYEYSGYDHTVNSHINRLRAKIEQTPNKPKFILTSWGVGYKFNDEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-32 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-33 44
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-22 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-22 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-28 43
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-23 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-29 42
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 8e-20 41
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-26 41
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-29 41
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-30 41
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-14 41
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator VFG1563 Protein 6e-33 46
Cycma_1189 YP_004773192.1 winged helix family two component transcriptional regulator VFG1702 Protein 6e-33 46