Gene Information

Name : Acife_0230 (Acife_0230)
Accession : YP_004782787.1
Strain : Acidithiobacillus ferrivorans SS3
Genome accession: NC_015942
Putative virulence/resistance : Resistance
Product : heavy metal transport/detoxification protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 238581 - 238787 bp
Length : 207 bp
Strand : -
Note : PFAM: Heavy metal transport/detoxification protein; KEGG: afr:AFE_1862 heavy metal-binding protein, putative

DNA sequence :
ATGAGCGATACCAGGCTGAAGATCACTGGTATGACCTGTGCGCACTGCGTGCGTGCCGTAACGAAGGCACTGGAAGGCGT
GCCCGGCGTGGCAAAGGCGGACGTCACGCTGGAGCCAGGAGAAGCTGTAGTGCATGGTCAGGCGAGCACCGCCGCACTGA
TCGCTGCGGTCAAGGAAGAAGGCTATGAGGCGGAGGTGCGGGGCTGA

Protein sequence :
MSDTRLKITGMTCAHCVRAVTKALEGVPGVAKADVTLEPGEAVVHGQASTAALIAAVKEEGYEAEVRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-06 45
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-06 45
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-06 45
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-06 45
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-06 45
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-06 45
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-07 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acife_0230 YP_004782787.1 heavy metal transport/detoxification protein BAC0679 Protein 7e-07 44