Gene Information

Name : SACTE_1859 (SACTE_1859)
Accession : YP_004802306.1
Strain : Streptomyces sp. SirexAA-E
Genome accession: NC_015953
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2066718 - 2067293 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: sgr:SGR_5133 putative TerD-family protein

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTCTCGCTGACCAAAGCCGCGCCGAACCTGACCGCGGTCACCGTGGGTCT
GGGCTGGGACGCCCGGACGACCACCGGTGGTGACTTCGACCTCGACGCCAGCGCCCTGCTGACGAACGCCGAGGGCAAGG
TCGGCAGCGACGGTAATTTCGTCTTCTTCAACAACCTCAAGAGCCCCGACGGATCGGTCGAGCACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAACGTCAACCTGGCGGCCGTCCCGGCCGACGTGGACAAGATCGTCTT
CCCGGTCTCGATCTACGAGGCCGAGTCCCGCCAGCAGAGCTTCGGCCAGGTGCGCAACGCCTACATCCGCGTGGTGAACC
AGGCGGACAACAGCGAACTCGCCCGTTACGACCTCAGCGAGGACGCCTCGACGGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGGTACGCGTCGGGTCTGCGCGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKAAPNLTAVTVGLGWDARTTTGGDFDLDASALLTNAEGKVGSDGNFVFFNNLKSPDGSVEHTGDNL
TGEGEGDDEVINVNLAAVPADVDKIVFPVSIYEAESRQQSFGQVRNAYIRVVNQADNSELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-61 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-60 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-61 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-61 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-57 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-57 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-57 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-56 63
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-33 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-29 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-29 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_1859 YP_004802306.1 stress protein BAC0389 Protein 9e-61 65
SACTE_1859 YP_004802306.1 stress protein BAC0390 Protein 6e-58 63
SACTE_1859 YP_004802306.1 stress protein BAC0392 Protein 9e-29 43