Gene Information

Name : SACTE_5274 (SACTE_5274)
Accession : YP_004805630.1
Strain : Streptomyces sp. SirexAA-E
Genome accession: NC_015953
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5967280 - 5967999 bp
Length : 720 bp
Strand : -
Note : KEGG: sen:SACE_6095 two-component system, response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGCCGCCCGGTCCGCCCGGCACACCGTCCTGGTCGTCGAGGACGACCCGAGCATCCGCACCCTGCTCACCTCGGCGCT
GCACGCGGCCGGTTATCGTGTCGCGCCGGCGGCGGACGGGCGGGAGGCCCTGGCCGAGACGGATCGCTGCCGGCCTGACC
TGATCGTGCTGGATGTGATGCTCCCGGACACCGACGGGTTCGCCGTGACGCGCGAGTTGCGCGCCCGGGGCGTCTACACC
CCGGTGCTGTTCCTGACCGCCCGCACCGAGGTCGAGGACAGGATCATCGGGCTCAGCTCGGGGGGCGACGACTACGTCAC
CAAGCCCTTCCACATCCAGGAGATCCTGCTGCGCGTCCGCGCCATCCTGCGCCGCACCGGCGGCCCGGCGCCCGTACCGG
CCGAGCGGCCCCCGCTGCGGTACGCGGACCTCGGCGTGGACCGCGAGCGGCACACGGTGCACCGCGGCGGACGTCCGGTG
CGGCTGTCCCCGACCGAGTTCCGCCTGCTGGTGTGCCTGGTCTCCCACCCGGAGAAGGTGCTGGAGAAGCGGGAGATCCT
CCAGGAGGTGTGGCAGTACGGCTTCGCCGGGGACACCCGCATCGTCGACACGTACATCAAGAACCTGCGCCGCAAGATCG
ACCAGGAGGGCCCGCCGCTGATCCACACCGTGCGCGGGGTGGGCTACTGCCTGCGGCTGCCCCGGGAGGGCTCGGCGTGA

Protein sequence :
MAARSARHTVLVVEDDPSIRTLLTSALHAAGYRVAPAADGREALAETDRCRPDLIVLDVMLPDTDGFAVTRELRARGVYT
PVLFLTARTEVEDRIIGLSSGGDDYVTKPFHIQEILLRVRAILRRTGGPAPVPAERPPLRYADLGVDRERHTVHRGGRPV
RLSPTEFRLLVCLVSHPEKVLEKREILQEVWQYGFAGDTRIVDTYIKNLRRKIDQEGPPLIHTVRGVGYCLRLPREGSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-38 44
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-42 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-35 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-41 43
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator BAC0083 Protein 8e-38 42
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-34 42
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-43 42
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-35 42
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 2e-33 42
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-32 41
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator BAC0638 Protein 8e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-54 50
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-47 47
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-38 44
SACTE_5274 YP_004805630.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-31 41