Gene Information

Name : Strvi_2323 (Strvi_2323)
Accession : YP_004812327.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2318871 - 2319695 bp
Length : 825 bp
Strand : +
Note : KEGG: sma:SAV_4416 two-component system response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGCAGCAGACCCCGTCTCCCACCCGCGTGCTCGTCGTGGACGACGATCCGACCGTGGCCGAGGTCGTCGCCGGGTACCT
CGGCCGGGCCGGATTCGCCGTGGACCAGGCAGCCGACGGCCCCGGGGCGCTCGCCCGCGCCGCCGCCCGCTGGCCGGACC
TGGTCGTCCTCGACCTGATGCTGCCCGGTATGGACGGGCTGGAGGTGTGCCGCGCGCTCCGGGGCAGGGGCCCGGTGCCG
GTCATCATGCTCACCGCGCGCGGCGACGAGGAGGACCGGATCCTCGGCCTGGAGATCGGCGCGGACGACTACGTCACCAA
GCCGTTCAGCCCACGGGAGCTGGTGCTGCGCGTGGAGTCTGTGCTGCGCCGCGGCCGGACCGGTCCGCAGGTCCCCGGCT
CGTCCGCCCCCGCCCCGGGCGGTGTGGCGCACCGCGCCGGGATCACCCTCGATGCCCTGGCCCGGCGCGCCACCCGGGAC
GGCCGGGAACTCGCCCTGACGGTGCGCGAGTTCGACCTGCTGTCCTTTCTGCTGCGCCACCCGGGGGTGGCCTTCACCCG
CGAGGAGCTGATGCGCGAGGTCTGGGGCTGGGACTTCGGGGATCTGTCCACCGTCACCGTCCATGTGCGGCGGCTGCGCG
GAAAGGTCGAGGACGATCCCGCCGCGCCCCGGCTCATCCAGACCGTCTGGGGCATCGGCTACCGCTTCGACGCCCCGCCC
GAGGCCGACGACGAGGGGCCACCGGACGACGGCCCAGGGGGCGAGGCGCGACGGGACGAGGGGCGACGGGACGGCGACGG
GCGGGGGGCGGGTTCCGATGCGTGA

Protein sequence :
MQQTPSPTRVLVVDDDPTVAEVVAGYLGRAGFAVDQAADGPGALARAAARWPDLVVLDLMLPGMDGLEVCRALRGRGPVP
VIMLTARGDEEDRILGLEIGADDYVTKPFSPRELVLRVESVLRRGRTGPQVPGSSAPAPGGVAHRAGITLDALARRATRD
GRELALTVREFDLLSFLLRHPGVAFTREELMREVWGWDFGDLSTVTVHVRRLRGKVEDDPAAPRLIQTVWGIGYRFDAPP
EADDEGPPDDGPGGEARRDEGRRDGDGRGAGSDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-40 45
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-37 44
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-28 43
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 5e-42 43
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-32 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-41 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator BAC0638 Protein 9e-25 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-39 42
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-32 44
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-26 43
Strvi_2323 YP_004812327.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-26 42