Gene Information

Name : Strvi_7521 (Strvi_7521)
Accession : YP_004817152.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 8578259 - 8578834 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein; KEGG: scb:SCAB_64341 stress protein

DNA sequence :
ATGGGCGTCACACTCGCCAAGGGGGGCAATGTCTCCCTCTCCAAAGCCGCTCCGAATCTCACACACGTGCTCATCGGCCT
GGGCTGGGACGCGCGCTCCACCACCGGAGCGCCGTTCGACCTCGACGCCAGCGCGCTGCTGTGCCAGTCGGGGCGGGTGC
TCGGCGATGAGTACTTCATCTTCTACAACAACCTCAAGAGCCCCGAGGGCTCCGTCGAGCACACCGGCGACAACCTCACC
GGTGAGGGCGAGGGCGACGACGAGTCCCTGCTGATCGATCTGGTCAAGGTCCCGGCCGAGGTCGACAAGATCGCCTTCCC
GGTCTCGATCCATGACGCCGATACCAGGCGCCAGACGTTCGGGCAGGTCAGCAACGCCTTCATCCGGGTGGTGAACCAGG
CGGACGGCCAGGAGCTGGCCCGCTACGACCTCTCCGAGGACGCCTCCGGCGAGACCGCGATGATCTTTGGCGAGGTTTAT
CGCTATGGGGGCGAGTGGAAGTTCAGGGCCGTGGGGCAAGGGTACGCGTCGGGTCTGCGCGGCATCGCTCTAGACTTCGG
AGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTHVLIGLGWDARSTTGAPFDLDASALLCQSGRVLGDEYFIFYNNLKSPEGSVEHTGDNLT
GEGEGDDESLLIDLVKVPAEVDKIAFPVSIHDADTRRQTFGQVSNAFIRVVNQADGQELARYDLSEDASGETAMIFGEVY
RYGGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-58 69
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-61 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-54 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-54 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-54 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-53 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_7521 YP_004817152.1 stress protein BAC0389 Protein 1e-58 68
Strvi_7521 YP_004817152.1 stress protein BAC0390 Protein 3e-58 62