Gene Information

Name : Strvi_8444 (Strvi_8444)
Accession : YP_004818038.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 9738170 - 9738850 bp
Length : 681 bp
Strand : -
Note : KEGG: sma:SAV_3481 two-component system response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGACCCGAGTACTGCTCGCCGAGGATGACGCATCCATCTCGGAGCCGCTCGCCCGCGCCCTGCGCCGCGAGGGGTACGA
GGTAGAGGTGCGCGAGGACGGACCCACCGCGCTCGACGCCGGTCTGCAAGGAGGCGTCGATCTGCTCGTCCTCGATCTCG
GCCTGCCCGGGATGGACGGGCTCGAGGTCTGTCGTCGGCTCCGTACGGAGGGCCACGGCTTTCCGGTGCTGGTGCTCACG
GCCCGCGCGGACGAGGTGGACACGGTGGTCGGCCTGGACGCCGGCGCCGACGACTACGTCACCAAGCCGTTCCGGCTCGC
CGAACTGCTCGCCCGGGTCCGGGCGCTGCTGCGGCGCGGTGCCGTCGAGACGCAGCAACAGCAGCCGGCCACCCATGGGG
TGCGGATCGACGTCGAGTCGCACCGCGCCTGGATGGGCGACGAGGAGCTGCAGCTCACCGCCAAGGAGTTCGATCTGCTG
CGGGTCCTGGTGCGGGACGCAGGGCGGGTCGTCACCCGCGATCAGCTCATGCGCGAGGTGTGGGACACCACGTGGTGGTC
GTCCACCAAGACCCTCGACATGCACATCTCCTGGCTGCGCAAGAAGCTCGGTGACGATGCGGCCAACCCCCGCTATATCG
CCACCGTCCGGGGTGTCGGCTTCCGATTCGAGAAAAGCTGA

Protein sequence :
MTRVLLAEDDASISEPLARALRREGYEVEVREDGPTALDAGLQGGVDLLVLDLGLPGMDGLEVCRRLRTEGHGFPVLVLT
ARADEVDTVVGLDAGADDYVTKPFRLAELLARVRALLRRGAVETQQQQPATHGVRIDVESHRAWMGDEELQLTAKEFDLL
RVLVRDAGRVVTRDQLMREVWDTTWWSSTKTLDMHISWLRKKLGDDAANPRYIATVRGVGFRFEKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-13 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-28 45
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-19 43
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-28 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-26 44
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-14 43
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-16 41
Strvi_8444 YP_004818038.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-21 41