Gene Information

Name : Strvi_8770 (Strvi_8770)
Accession : YP_004818354.1
Strain : Streptomyces violaceusniger Tu 4113
Genome accession: NC_015957
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 10123350 - 10123925 bp
Length : 576 bp
Strand : +
Note : PFAM: Bacterial stress protein; KEGG: sgr:SGR_4049 TerD-family protein

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGCGGCAACGTCTCGCTCACCAAGGAGGCACCGGGCCTGACCGCCGTCACGGTCGGCCT
CGGCTGGGACGTCCGCACCACCACGGGCACCGACTTCGACCTCGACGCGAGTGCCATCGCCGTGAACGCGAACGGCAAGG
TCTACTCCGACCAGCACTTCGTGTTCTTCAACAACAAGTCCACCCCGGACCAGACCATCGTCCACACCGGTGACAACGTC
ACCGGTCAGGGCGAGGGCGACGACGAGCAGATCAACGTCAACCTGGCCGGTCTGCCGGCCGACGTGGAGAAGATCGTCTT
CCCGGTCTCGATCTACGACGCCGAGTCCCGCAGCCAGAACTTCGGCCAGGTGCGGAACGCGTTCATCCGCATCGTCAACC
AGGCCGGCGGCACCGAGATCGCCCGCTACGACCTGAGCGAGGACGCCGCGACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCGGAGTGGAAGTTCCGTGCCGTGGGCCAGGGCTACGCCGCCGGTCTCGTGGGCATCGCCCAGGACTT
CGGCGTCAGCGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNANGKVYSDQHFVFFNNKSTPDQTIVHTGDNV
TGQGEGDDEQINVNLAGLPADVEKIVFPVSIYDAESRSQNFGQVRNAFIRIVNQAGGTEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYAAGLVGIAQDFGVSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-58 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-58 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strvi_8770 YP_004818354.1 stress protein BAC0390 Protein 5e-59 63
Strvi_8770 YP_004818354.1 stress protein BAC0389 Protein 4e-57 60