Gene Information

Name : Rhom172_1428 (Rhom172_1428)
Accession : YP_004825190.1
Strain : Rhodothermus marinus SG0.5JP17-172
Genome accession: NC_015966
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1634930 - 1635625 bp
Length : 696 bp
Strand : -
Note : KEGG: rmr:Rmar_1374 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver re

DNA sequence :
ATGTGGATTCTGCTGGTGGAAGACGATGAGCGGCTGGCGCGGGCGTTGGCCCGGGGGCTTCGTGAAGAAGGATACCAGGT
GGATCGGGTGGCCGACGGGGTGGAAGCGGAGGCCCGTGTGCAGGCCAGCCATTACGATGCGCTGATCGTGGACTGGCGGT
TGCCCCGGATGGACGGCCAGACGCTGGTGCGGCGCCTGCGGGAGGCCGGCTATCAGATGCCGATCCTGATGCTGACGGCG
CTGGACGACCTCGAACACCGGGTGGCCGGACTGGACGCCGGAGCCGACGACTATCTGGGAAAACCTTTCGCCTTCGAGGA
GTTGCTGGCCCGGTTGCGGGCGCTGCTGCGCCGTTCGCCCGTCTGGCAGGCAACCGACGTGATCCGCCTGGGGCCGCTGG
AGATCAACGAGCGGCGCCGCCAGGTCCGGGTGGGTGAGTACGTCCTGCCGCTGCGGCCCAAGGAGTACGATCTGCTGCGC
TTTCTGGCGCGTCATCCGGGCGAGGTGCTCTCGCGCACGCGGATTGCCGAGCAGGTCTGGGGCGACCCATTCTACGTGAG
CGACAACACGATCGACGTGACCGTTTCCGGATTGCGCCAGAAGCTGAGCGACGCTTCTCCGGCGCTGCAGATCGAAACCG
TCCGGGGGGTCGGCTACGCCCTGCGGCTTGAACCGTCCGCCACGGAAACGCCATGA

Protein sequence :
MWILLVEDDERLARALARGLREEGYQVDRVADGVEAEARVQASHYDALIVDWRLPRMDGQTLVRRLREAGYQMPILMLTA
LDDLEHRVAGLDAGADDYLGKPFAFEELLARLRALLRRSPVWQATDVIRLGPLEINERRRQVRVGEYVLPLRPKEYDLLR
FLARHPGEVLSRTRIAEQVWGDPFYVSDNTIDVTVSGLRQKLSDASPALQIETVRGVGYALRLEPSATETP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-28 46
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-22 45
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-27 44
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-27 44
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-28 44
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-27 43
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-20 43
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-24 43
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-28 47
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-22 42
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator VFG0473 Protein 5e-21 41
Rhom172_1428 YP_004825190.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-26 41