Gene Information

Name : Entas_0605 (Entas_0605)
Accession : YP_004827142.1
Strain : Enterobacter asburiae LF7a
Genome accession: NC_015968
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 643852 - 644541 bp
Length : 690 bp
Strand : +
Note : KEGG: ent:Ent638_0559 DNA-binding response regulator CreB; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGCAGCAACCTGTTGTCTGGCTGGTTGAAGACGAAATCAGCATCGCCGATACGCTTATCTACATGCTCCAGCAGGAAGG
ATTCGCGGTGAAGGCGTTTGATCGCGGTTTGCCGGTGCTGGAAGAGGCGCGGCGGCAGGTTCCTGCACTGGCTATTCTGG
ACGTCGGCCTGCCGGATATCAGCGGCTTTGAACTGTGTCGCCAGCTACTGGCGCTGCATCCGTCGTTGCCGGTGCTGTTT
CTGACGGCACGCAGTGATGAAGTGGACAAACTGCTCGGCCTGGAAATGGGCGCGGATGACTACGTTGCCAAACCTTTCTC
GCCGCGTGAAGTGTGCGCCCGGGTAAGGACAATCCTGCGACGGATGCAAAAATCCGCCGCACCCTCTGAAATCGTCCGAA
TCGGGCAGTTCGAGCTGAACGAGCCTGCGGCCCGAATCAGCTGGTGCGGAGAACCTCTGCTGCTGACCCGCTACGAGTTC
CTGCTGCTCAAAACGCTGTTGCAGGCACCAGGGCGCGTGTTTTCGCGCCAACAGCTTATGGATAAAGTCTGGGGTGACGA
CGGCGACAGTTTTGATCGTACTGTAGATACCCATATCAAAACCCTGCGTGCCAAGCTGCGAGCGGTGAATGACACGCTTT
CGCCCATCAGCACCCATCGCGGAATGGGCTACAGTCTGGGGCTTTATTAA

Protein sequence :
MQQPVVWLVEDEISIADTLIYMLQQEGFAVKAFDRGLPVLEEARRQVPALAILDVGLPDISGFELCRQLLALHPSLPVLF
LTARSDEVDKLLGLEMGADDYVAKPFSPREVCARVRTILRRMQKSAAPSEIVRIGQFELNEPAARISWCGEPLLLTRYEF
LLLKTLLQAPGRVFSRQQLMDKVWGDDGDSFDRTVDTHIKTLRAKLRAVNDTLSPISTHRGMGYSLGLY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-18 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 6e-34 44
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-33 43
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-33 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 1e-30 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-33 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-35 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-33 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-33 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-35 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-33 42
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-22 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Entas_0605 YP_004827142.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-19 42