Gene Information

Name : SLG_13280 (SLG_13280)
Accession : YP_004834460.1
Strain : Sphingobium sp. SYK-6
Genome accession: NC_015976
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1441366 - 1441812 bp
Length : 447 bp
Strand : +
Note : -

DNA sequence :
ATGGCAGGCATGACGATATCGAAACTTGCGCAAGCGGGCGGCGTTGGCGTCGAGACGGTGCGTTATTATCAGCGCCGCGG
GCTCCTGGCGCTGCCTGAGCGGGGCGGGGGGCGCGCGCTATCCGGGGGCGTGCGGCGTTATGATGACGAGGATGTGCGCC
GCCTGCGCTTCATCCGCTCGGCCCAGTTGGCTGGCTTCACTCTGGATGCGATCGGAGAGCTGCTCTCGCTGGACGCGGGG
GAAGACCGGGTACGCGCGCGCCAGCTCGCCGCCGAGAGGTTGACGGCGCTGGATGCCAAAATCGCCGAGCTTCAGCGTGC
CCGGGCGGTGTTGCAAAAACTCGCGCTGGAATGCGAATCCTCGGGGATGGGGCCATGCCCGATCCTCTCTTCGTTCGATG
ACGCCGCCGAGTCGCGCCCGCAAACGGGTGGGGTGACTGCGCTATAG

Protein sequence :
MAGMTISKLAQAGGVGVETVRYYQRRGLLALPERGGGRALSGGVRRYDDEDVRRLRFIRSAQLAGFTLDAIGELLSLDAG
EDRVRARQLAAERLTALDAKIAELQRARAVLQKLALECESSGMGPCPILSSFDDAAESRPQTGGVTAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 5e-24 42
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 9e-22 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-23 42
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 4e-23 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-22 41
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-22 41
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-22 41
merR AGK07025.1 MerR Not tested SGI1 Protein 7e-22 41
merR AGK07083.1 MerR Not tested SGI1 Protein 7e-22 41
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-22 41
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SLG_13280 YP_004834460.1 MerR family transcriptional regulator BAC0688 Protein 1e-24 43
SLG_13280 YP_004834460.1 MerR family transcriptional regulator BAC0684 Protein 2e-23 43
SLG_13280 YP_004834460.1 MerR family transcriptional regulator BAC0689 Protein 6e-24 43
SLG_13280 YP_004834460.1 MerR family transcriptional regulator BAC0232 Protein 5e-23 42
SLG_13280 YP_004834460.1 MerR family transcriptional regulator BAC0683 Protein 3e-23 42
SLG_13280 YP_004834460.1 MerR family transcriptional regulator BAC0687 Protein 5e-23 42
SLG_13280 YP_004834460.1 MerR family transcriptional regulator BAC0686 Protein 7e-25 41