Gene Information

Name : SLG_13310 (SLG_13310)
Accession : YP_004834463.1
Strain : Sphingobium sp. SYK-6
Genome accession: NC_015976
Putative virulence/resistance : Virulence
Product : OmpR family two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1444261 - 1444926 bp
Length : 666 bp
Strand : -
Note : -

DNA sequence :
ATGCGCCTGCTGATCGTTGAGGATGAACCGACACTGGGCACCCAGCTCAAGGCCACGCTGGAAGGCGCCGGCTATGCGGT
CGACCTCGCCACGGATGGCGAAGATGGCCATTTCCTCGGGTCCACCGAGAGCTATGACGCCATCGTCCTCGACCTTGGCC
TGCCCGAAATCGACGGCCTGACCGTTCTCGATCGCTGGCGCAAGGAAGGCTCGCAGGTCCCCGTGCTCGTCCTGACCGCG
CGTGACAGCTGGTCGGACAAGGTCGCCGGGCTGGACGCGGGCGCCGACGACTATCTCGCCAAGCCATTCCAGAGCGAGGA
ACTGATCGCCCGCCTGCGCGCGCTCATCCGTCGCTCTTCCGGCAATGCCTCGAGCGAACTCATCGCCGGCGATGTGCGCC
TCGACACCCGCTCGGGCAAGGTGACGCTCAATGGCGAGCCGGTGAAGCTGACGGCTCAGGAATATAAGCTGCTCTCATAC
CTCATGCATCACAAGGGCAAGGTGGTCAGCCGCACGGAGCTGATCGAGCATATCTACGATCAGGATTTCGACCGGGATTC
CAACACCATAGAGGTTTTCGTGACGCGGATCCGCAAGAAGCTCGGCGCCGACGTGATCTCGACGATCAGGGGGCTGGGCT
ACAGCCTGGACGAACCCGCTGGCTGA

Protein sequence :
MRLLIVEDEPTLGTQLKATLEGAGYAVDLATDGEDGHFLGSTESYDAIVLDLGLPEIDGLTVLDRWRKEGSQVPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQSEELIARLRALIRRSSGNASSELIAGDVRLDTRSGKVTLNGEPVKLTAQEYKLLSY
LMHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGADVISTIRGLGYSLDEPAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 6e-24 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator NC_002516.2.879194.p Protein 1e-31 47
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator BAC0487 Protein 1e-26 47
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator CP000647.1.gene1136. Protein 3e-32 44
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator CP004022.1.gene1005. Protein 2e-32 44
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator CP001918.1.gene2526. Protein 6e-31 44
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator BAC0530 Protein 4e-32 44
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator CP000034.1.gene2022. Protein 2e-31 43
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator NC_002695.1.913289.p Protein 3e-31 43
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator CP001138.1.gene1939. Protein 9e-32 43
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator BAC0111 Protein 7e-27 42
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator BAC0083 Protein 4e-24 42
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator BAC0197 Protein 3e-26 42
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator BAC0308 Protein 2e-21 42
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator BAC0638 Protein 8e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator VFG0473 Protein 1e-23 45
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator VFG0475 Protein 8e-32 43
SLG_13310 YP_004834463.1 OmpR family two-component system response regulator VFG1390 Protein 3e-22 42