Gene Information

Name : LIV_1463 (LIV_1463)
Accession : YP_004855218.1
Strain : Listeria ivanovii PAM 55
Genome accession: NC_016011
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1525436 - 1526122 bp
Length : 687 bp
Strand : +
Note : Similar to two-component response regulators

DNA sequence :
ATGAAACTACTTATGATTGAAGATAATGTGAGTGTATGTGAAATGATTGAAATGTTTTTCATAAAAGAAGAAATTAATGC
CACGTTTGTGCATGATGGCAAACTAGGCTATGAGACTTTTTTAAAAGAAGACTTTGATATCGCCATTATTGATTTAATGC
TTCCGAACATGGATGGAATGACAATTTGTCGCAAAATCCGCGAAGTCAGTGATATGCCGATTATTATTTTAACGGCGAAA
GAATCCGAATCTGATCAAGTGCTTGGTCTAGAAATGGGCGCTGATGATTATGTTACTAAACCATTTAGTCCCCTTACTTT
GATGGCACGAATAAAAGCAGTAACTCGTCGTAAAAATAGTTCAACTTTGGCAGAAACAGATGAGGATATTCTAGAAACAA
CCTATTTTAAAATTAGTAAACGAACTCGAGAAATTTTTTATCAAGGTGAATTACTGGATGCATTAACACCAAAAGAATTT
GATTTGCTTTATTTCTTGATGAAGCACCCAAGACAGGTTTTCTCAAGAGAACAATTGCTAGAGCAAGTCTGGGGTTACCA
ATTTTACGGAGACGAACGAACAGTTGATGTTCATATTAAACGTTTACGCCAAAAAATTGCTACAGAAACGAAGCCATTTT
TACACACTATTTGGGGTGTAGGCTATAAATTCGATGAAACGGAATGA

Protein sequence :
MKLLMIEDNVSVCEMIEMFFIKEEINATFVHDGKLGYETFLKEDFDIAIIDLMLPNMDGMTICRKIREVSDMPIIILTAK
ESESDQVLGLEMGADDYVTKPFSPLTLMARIKAVTRRKNSSTLAETDEDILETTYFKISKRTREIFYQGELLDALTPKEF
DLLYFLMKHPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRQKIATETKPFLHTIWGVGYKFDETE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-35 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LIV_1463 YP_004855218.1 putative two-component response regulator NC_010400.5986590.p0 Protein 5e-37 45
LIV_1463 YP_004855218.1 putative two-component response regulator NC_012469.1.7686381. Protein 2e-40 44
LIV_1463 YP_004855218.1 putative two-component response regulator DQ212986.1.gene4.p01 Protein 2e-30 44
LIV_1463 YP_004855218.1 putative two-component response regulator CP000034.1.gene2186. Protein 7e-29 44
LIV_1463 YP_004855218.1 putative two-component response regulator NC_002695.1.916589.p Protein 6e-29 44
LIV_1463 YP_004855218.1 putative two-component response regulator BAC0039 Protein 7e-29 44
LIV_1463 YP_004855218.1 putative two-component response regulator NC_012469.1.7685629. Protein 6e-38 43
LIV_1463 YP_004855218.1 putative two-component response regulator AE016830.1.gene1681. Protein 1e-39 43
LIV_1463 YP_004855218.1 putative two-component response regulator HE999704.1.gene2815. Protein 1e-43 43
LIV_1463 YP_004855218.1 putative two-component response regulator FJ349556.1.orf0.gene Protein 2e-37 43
LIV_1463 YP_004855218.1 putative two-component response regulator CP001918.1.gene3444. Protein 1e-28 43
LIV_1463 YP_004855218.1 putative two-component response regulator AE015929.1.gene1106. Protein 8e-30 42
LIV_1463 YP_004855218.1 putative two-component response regulator HE999704.1.gene1202. Protein 2e-30 42
LIV_1463 YP_004855218.1 putative two-component response regulator AM180355.1.gene1830. Protein 2e-30 42
LIV_1463 YP_004855218.1 putative two-component response regulator AF130997.1.orf0.gene Protein 4e-29 42
LIV_1463 YP_004855218.1 putative two-component response regulator NC_005054.2598277.p0 Protein 3e-34 42
LIV_1463 YP_004855218.1 putative two-component response regulator NC_014475.1.orf0.gen Protein 3e-34 42
LIV_1463 YP_004855218.1 putative two-component response regulator CP000647.1.gene2531. Protein 3e-28 42
LIV_1463 YP_004855218.1 putative two-component response regulator CP000034.1.gene3671. Protein 8e-37 42
LIV_1463 YP_004855218.1 putative two-component response regulator NC_011595.7057856.p0 Protein 4e-37 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_010410.6002989.p0 Protein 4e-37 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_010079.5776364.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_002952.2859858.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_007622.3794948.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_003923.1003417.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_013450.8614146.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_002951.3238224.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_007793.3914065.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator NC_002758.1121390.p0 Protein 2e-32 41
LIV_1463 YP_004855218.1 putative two-component response regulator CP001138.1.gene2239. Protein 2e-27 41
LIV_1463 YP_004855218.1 putative two-component response regulator BAC0596 Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LIV_1463 YP_004855218.1 putative two-component response regulator VFG1563 Protein 4e-35 47
LIV_1463 YP_004855218.1 putative two-component response regulator VFG1702 Protein 7e-35 47