Gene Information

Name : phoP (LIV_2411)
Accession : YP_004856132.1
Strain : Listeria ivanovii PAM 55
Genome accession: NC_016011
Putative virulence/resistance : Virulence
Product : putative two-component response phosphate regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2555406 - 2556116 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
TTGGTAAAAATTCTTGTAGTTGATGATGAGGCTTCTATTGTTACCTTGCTGCAATTTAATATTGAAAAGGCTGGATTTGA
AGTGGTGACAGCAGAAGATGGTAGGGCTGGATATGAACTAGCTTTATCAGAGAAACCAGATTTAATTGTACTTGATTTAA
TGCTTCCTGAAATGGATGGAATCGAAGTGACAAAAAAACTTCGTCAAAATAAAGTAAATGTTCCCATATTAATGTTAACA
GCAAAAGATGAAGAATTAGATAAAATCATTGGTTTAGAGCTTGGTGCGGATGATTATATGACAAAACCATTTAGCCCACG
AGAAGTAGTCGCACGAATTAAAGCCATTTTACGTCGGACAGAAGGTAAAGCGGAGGCAGTAGAAGAAAATTCGGACGAAA
TGGAAGCAATGATTTTAATTGGTGATTTGAAAATTTTACCAGAAAGCTATGAAGTGTATTTACAAGAAGAATTGCTAGAT
TTAACGCCAAAAGAATTCGAGCTATTATTATTTCTTGCAAATCATCGCGGCAAAGTTTTTTCACGAGATCAATTGCTGGA
TACTGTGTGGAACTATGATTACGTTGGAGAAACACGAATTGTGGATGTTCATGTAAGCCATTTGCGTGATAAAATTGAAA
CAGATACCAAACAACCAAAGTATATCAAAACGATTCGCGGCTTTGGTTATAAAATGGAGAATGTAAAATAA

Protein sequence :
MVKILVVDDEASIVTLLQFNIEKAGFEVVTAEDGRAGYELALSEKPDLIVLDLMLPEMDGIEVTKKLRQNKVNVPILMLT
AKDEELDKIIGLELGADDYMTKPFSPREVVARIKAILRRTEGKAEAVEENSDEMEAMILIGDLKILPESYEVYLQEELLD
LTPKEFELLLFLANHRGKVFSRDQLLDTVWNYDYVGETRIVDVHVSHLRDKIETDTKQPKYIKTIRGFGYKMENVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-42 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-42 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_004856132.1 putative two-component response phosphate regulator HE999704.1.gene2815. Protein 1e-103 94
phoP YP_004856132.1 putative two-component response phosphate regulator NC_002952.2859905.p0 Protein 4e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_002951.3237708.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_002758.1121668.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_009641.5332272.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_013450.8614421.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_007622.3794472.p0 Protein 4e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_007793.3914279.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_003923.1003749.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_002745.1124361.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator NC_009782.5559369.p0 Protein 3e-68 60
phoP YP_004856132.1 putative two-component response phosphate regulator AE016830.1.gene1681. Protein 1e-69 56
phoP YP_004856132.1 putative two-component response phosphate regulator NC_012469.1.7685629. Protein 2e-56 55
phoP YP_004856132.1 putative two-component response phosphate regulator NC_012469.1.7686381. Protein 2e-61 50
phoP YP_004856132.1 putative two-component response phosphate regulator CP001485.1.gene721.p Protein 5e-36 43
phoP YP_004856132.1 putative two-component response phosphate regulator AF162694.1.orf4.gene Protein 4e-38 43
phoP YP_004856132.1 putative two-component response phosphate regulator AE000516.2.gene3505. Protein 2e-39 43
phoP YP_004856132.1 putative two-component response phosphate regulator CP004022.1.gene3215. Protein 4e-37 42
phoP YP_004856132.1 putative two-component response phosphate regulator CP001918.1.gene5135. Protein 4e-29 42
phoP YP_004856132.1 putative two-component response phosphate regulator NC_011595.7057856.p0 Protein 5e-36 41
phoP YP_004856132.1 putative two-component response phosphate regulator NC_010400.5986590.p0 Protein 1e-35 41
phoP YP_004856132.1 putative two-component response phosphate regulator NC_010410.6002989.p0 Protein 5e-36 41
phoP YP_004856132.1 putative two-component response phosphate regulator HE999704.1.gene1528. Protein 2e-37 41
phoP YP_004856132.1 putative two-component response phosphate regulator NC_005054.2598277.p0 Protein 1e-39 41
phoP YP_004856132.1 putative two-component response phosphate regulator EU250284.1.orf4.gene Protein 2e-39 41
phoP YP_004856132.1 putative two-component response phosphate regulator NC_014475.1.orf0.gen Protein 1e-39 41
phoP YP_004856132.1 putative two-component response phosphate regulator AF155139.2.orf0.gene Protein 4e-41 41
phoP YP_004856132.1 putative two-component response phosphate regulator CP001138.1.gene4273. Protein 1e-32 41
phoP YP_004856132.1 putative two-component response phosphate regulator NC_002695.1.915041.p Protein 2e-32 41
phoP YP_004856132.1 putative two-component response phosphate regulator CP000034.1.gene3834. Protein 2e-32 41
phoP YP_004856132.1 putative two-component response phosphate regulator AM180355.1.gene1830. Protein 7e-39 41
phoP YP_004856132.1 putative two-component response phosphate regulator CP000034.1.gene3671. Protein 4e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_004856132.1 putative two-component response phosphate regulator VFG1563 Protein 6e-43 42
phoP YP_004856132.1 putative two-component response phosphate regulator VFG1702 Protein 7e-43 42
phoP YP_004856132.1 putative two-component response phosphate regulator VFG1386 Protein 4e-40 42
phoP YP_004856132.1 putative two-component response phosphate regulator VFG1389 Protein 6e-34 41