Gene Information

Name : Bcoa_3255 (Bcoa_3255)
Accession : YP_004861207.1
Strain : Bacillus coagulans 36D1
Genome accession: NC_016023
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3458636 - 3459319 bp
Length : 684 bp
Strand : -
Note : KEGG: lsg:lse_1294 two-component DNA-binding response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region; Signal tran

DNA sequence :
ATGAAACGTATATTACTGGTGGAAGATGAAAAAAATCTGGCCCGTTTTATTGAGCTGGAGTTAAGGCATGAAGGATACGA
AGTGAAAGTGGCGTATGACGGACGGGAAGGGTTGCAGTCGGCTTTGGAGGAGGATTGGGATGTGATTCTCCTTGATTTAA
TGCTGCCGAAACTGAACGGCCTTGAAGTATGCCGCCGCTTACGACAGGAAAAAGAAACACCGGTCATCATGATTACCGCC
CGGGACAGCATTATGGACCGGGTATCCGGGCTTGACCACGGGGCGGATGATTATATTGTCAAACCATTTGCGATTGAAGA
ATTGCTCGCAAGGCTAAGGGCCATTTTCAGAAGGATGGAGTACGCCGAGCCCAAAAAAGCAGCGCTAACAACGTACAAGT
TCCGTGACCTTGTGCTGGAAAAAGAAAGCCGGCTTGTTAAAAAGGCAGGAAAAACCATTGAGTTGACAAAACGGGAATAC
GATTTGTTGCTTACGCTTTTGGAAAATAAAAATATTGTCATGACCCGGGAAGCACTCCTGAACAAAGTATGGGGATATGA
AACCGAGGTCGAAACGAATGTTGTCGATGTGTACATCCGGTACTTGCGCAATAAAATTGATACAGAAGGCGAAGACAGCT
ATATTCAGACAGTGCGGGGGACAGGATATGTGATGCGCGAATGA

Protein sequence :
MKRILLVEDEKNLARFIELELRHEGYEVKVAYDGREGLQSALEEDWDVILLDLMLPKLNGLEVCRRLRQEKETPVIMITA
RDSIMDRVSGLDHGADDYIVKPFAIEELLARLRAIFRRMEYAEPKKAALTTYKFRDLVLEKESRLVKKAGKTIELTKREY
DLLLTLLENKNIVMTREALLNKVWGYETEVETNVVDVYIRYLRNKIDTEGEDSYIQTVRGTGYVMRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-36 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-36 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-74 76
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-59 59
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-53 57
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-40 43
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-36 43
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-38 42
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-33 42
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-46 44
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-37 44
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-41 44
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-36 43
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-36 42
Bcoa_3255 YP_004861207.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-39 42