Gene Information

Name : Cabther_A0067 (Cabther_A0067)
Accession : YP_004861363.1
Strain :
Genome accession: NC_016024
Putative virulence/resistance : Resistance
Product : response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 83030 - 83749 bp
Length : 720 bp
Strand : +
Note : -

DNA sequence :
ATGAAACGCAACATTGTCATCATTGAGGATGATGCCGACATTGCCCAGTCCATTCGTTACAACCTGGAGCAGGAAGGGTC
ATTTCACGTCACCATCACAACTACGGGGGAAGCCGGTCTCCGCACGGTTCTGGAGCATCCGCCAAGCCTCATTCTGCTCG
ACCTCAACCTGCCCCTGATGAATGGGTTTGAAATCTGCCGGCGTCTGCGCCGCGAAGAAGCCACGGCCCAGGTGCCGATC
ATCATGCTGACGGCGCGGACGGACGAAACCGACAAAATTCACGGGCTGGGACTGGGGGCGGATGATTACGTAACCAAGCC
GTTCAGCGTGCGCGAACTGATGGCGCGCATCAACGCCGTCCTGCGCCGAACGGAAGGCAATCCCTCTTCCGTCTATGACG
ACGGGACGCTGTTTATTGACTACAACCATTTCATCGTCCGCTGTCAGGGGCAGGAAATCAACATGACCCGCAAGGAGTTT
GCGCTGCTCAAGCTTCTGGCCCAGAGCAAGGGCCGGGTGCTCACGCGGGAATACCTGTTAGACCGGGTGTGGGGCATTGA
CTACGATGGGGAGACGCGCACCCTTGATGTGCACATCCGGCGCGTACGTCAAAAGCTGGGCATTGATGGCTACATCGAAA
CAGCCGTCGGGATCGGCTACCGCTTCGTGGAAGCCGGCAAGCAGGCGGCCAAGCTCCCAAAACCTTCCGAGAAACCGTAA

Protein sequence :
MKRNIVIIEDDADIAQSIRYNLEQEGSFHVTITTTGEAGLRTVLEHPPSLILLDLNLPLMNGFEICRRLRREEATAQVPI
IMLTARTDETDKIHGLGLGADDYVTKPFSVRELMARINAVLRRTEGNPSSVYDDGTLFIDYNHFIVRCQGQEINMTRKEF
ALLKLLAQSKGRVLTREYLLDRVWGIDYDGETRTLDVHIRRVRQKLGIDGYIETAVGIGYRFVEAGKQAAKLPKPSEKP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_003923.1003417.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_013450.8614146.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_002951.3238224.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_007793.3914065.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_002758.1121390.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_010079.5776364.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_002952.2859858.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_007622.3794948.p0 Protein 6e-32 44
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein HE999704.1.gene2815. Protein 6e-36 43
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein AE015929.1.gene1106. Protein 1e-27 42
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein CP001485.1.gene721.p Protein 5e-23 42
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein U35369.1.gene1.p01 Protein 9e-32 41
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein AE016830.1.gene2255. Protein 9e-32 41
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein NC_012469.1.7685629. Protein 3e-32 41
Cabther_A0067 YP_004861363.1 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein AE000516.2.gene3505. Protein 6e-27 41