Gene Information

Name : yclJ (GYO_0768)
Accession : YP_004876097.1
Strain : Bacillus subtilis TU-B-10
Genome accession: NC_016047
Putative virulence/resistance : Virulence
Product : two-component response regulator YclJ
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 698744 - 699457 bp
Length : 714 bp
Strand : -
Note : -

DNA sequence :
ATGAATGAAATGATGGATAAAACTAAAATACTTATTATTGAAGATGACGAAGCAATAGCTGATCTACTTTCATACGGGCT
TGCGCAGGAAGGTTTTCAAACGTGTACTGAGGCTAACGGCGCTTTAGGATTGAAACAGCTAGATCAATTCAAACCCGATC
TTCTGCTGCTCGATTGGATGCTGCCAGATTGCAGCGGATTGGATATCTGTAAAATAGTGACCCATCGCTATAATATCCCT
ATCCTTATGATCACCGCAAAGTCAGACATCACCGATAAAGTACTTGGGTTGGAATTTGGGGCCGATGATTATATTACAAA
GCCATTTGACTTACGCGAGGTTATTGCTAGAATTCGTACGATACTTAGGCGTCTTGAACAAGCTAACCACGTTCATGATC
GAGGAACGTCTAATGAGGAACCTATTCAGTTTAAAAATATTGTGATCATCCCAGACGAAAGAATAGTAAAAAAAGACGGG
ATCATTGTTGATTTGACTCCTAAAGAATTCGATCTGCTTAAGACGTTGATTGACCATCGGGGGAAAATTTTCACACGTTC
AGAGCTGTTGGAATTTATCTGGGGATATGATTTTGCCGGGGATACACGTACGGTAGATACTCATATTCAAAGACTCCGTA
AAAAACTGAATGCAAGTGACTTGATTAAAACAGTATTTGGCATCGGATATAAATGTGAGAAGCAGGAGGAGTAG

Protein sequence :
MNEMMDKTKILIIEDDEAIADLLSYGLAQEGFQTCTEANGALGLKQLDQFKPDLLLLDWMLPDCSGLDICKIVTHRYNIP
ILMITAKSDITDKVLGLEFGADDYITKPFDLREVIARIRTILRRLEQANHVHDRGTSNEEPIQFKNIVIIPDERIVKKDG
IIVDLTPKEFDLLKTLIDHRGKIFTRSELLEFIWGYDFAGDTRTVDTHIQRLRKKLNASDLIKTVFGIGYKCEKQEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-27 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_004876097.1 two-component response regulator YclJ NC_002952.2859905.p0 Protein 2e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_002745.1124361.p0 Protein 3e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_009782.5559369.p0 Protein 3e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_002951.3237708.p0 Protein 3e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_003923.1003749.p0 Protein 2e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_002758.1121668.p0 Protein 3e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_007622.3794472.p0 Protein 2e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_009641.5332272.p0 Protein 3e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_013450.8614421.p0 Protein 3e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ NC_007793.3914279.p0 Protein 3e-36 46
yclJ YP_004876097.1 two-component response regulator YclJ HE999704.1.gene2815. Protein 3e-34 44
yclJ YP_004876097.1 two-component response regulator YclJ NC_012469.1.7685629. Protein 6e-34 43
yclJ YP_004876097.1 two-component response regulator YclJ DQ212986.1.gene4.p01 Protein 2e-25 42
yclJ YP_004876097.1 two-component response regulator YclJ BAC0039 Protein 2e-26 42
yclJ YP_004876097.1 two-component response regulator YclJ CP001918.1.gene3444. Protein 3e-25 42
yclJ YP_004876097.1 two-component response regulator YclJ CP000034.1.gene2186. Protein 2e-26 42
yclJ YP_004876097.1 two-component response regulator YclJ NC_002695.1.916589.p Protein 2e-26 42
yclJ YP_004876097.1 two-component response regulator YclJ NC_013450.8614146.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_002951.3238224.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_007793.3914065.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_002758.1121390.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_010079.5776364.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_002952.2859858.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_007622.3794948.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_003923.1003417.p0 Protein 6e-28 41
yclJ YP_004876097.1 two-component response regulator YclJ NC_012469.1.7686381. Protein 1e-33 41
yclJ YP_004876097.1 two-component response regulator YclJ BAC0596 Protein 4e-25 41
yclJ YP_004876097.1 two-component response regulator YclJ CP001138.1.gene2239. Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_004876097.1 two-component response regulator YclJ VFG1702 Protein 1e-27 42
yclJ YP_004876097.1 two-component response regulator YclJ VFG1563 Protein 7e-27 41