Gene Information

Name : TEH_11180 (TEH_11180)
Accession : YP_004886609.1
Strain : Tetragenococcus halophilus NBRC 12172
Genome accession: NC_016052
Putative virulence/resistance : Virulence
Product : OmpR family two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1107600 - 1108304 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
TTGAAAAAAATATTAGTTGTTGATGACGAAAAACCGATTACTGACATTGTTAATTTTAATTTGTCAAAAGAAGGTTATGA
AGTTTATACAGCTTATGACGGAGAAGAAGCATTAGAACAAGTAGAAGAGGTGAAACCTGATTTAGTTTTACTTGATTTAA
TGTTACCCAAAGTCGATGGGCTAGAAGTGGCGCGTGAAATTCGCAAAACTTATGATATGCCAATCATTATGGTGACTGCT
AAAGACGCAGAAATCGATAAAGTCTTAGGCTTGGAATTAGGAGCAGATGATTATGTTACAAAACCATTTTCTAATCGTGA
GTTAGTCGCTCGTGTTAAAGCTAATCTAAGACGAGGATCTTCCAGCGCTAAAGGCGCTGATCAAGCAGCCAATGTAGAGA
TTACAATCAATGATATTACCATTCACCCGGATGCTTATATGGTTACAAAAAATGAGGAAGAGATTGAATTGACCCACCGT
GAGTTTGAACTGTTACATTACTTAGCACAACATATTGGACAAGTAATGACGCGTGAACATTTATTACAAACGGTGTGGGG
TTATGATTATTTTGGCGATGTACGTACTGTGGACGTAACAGTGCGACGCTTACGCGAAAAAATCGAAGATAACGCTAGCC
ATCCAGGCTATTTAGTTACACGTCGAGGCGTAGGCTATTATTTACGCAATCCAGAACAGGAGTAA

Protein sequence :
MKKILVVDDEKPITDIVNFNLSKEGYEVYTAYDGEEALEQVEEVKPDLVLLDLMLPKVDGLEVAREIRKTYDMPIIMVTA
KDAEIDKVLGLELGADDYVTKPFSNRELVARVKANLRRGSSSAKGADQAANVEITINDITIHPDAYMVTKNEEEIELTHR
EFELLHYLAQHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNASHPGYLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_012469.1.7685629. Protein 3e-68 69
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002952.2859905.p0 Protein 3e-51 54
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_007622.3794472.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002758.1121668.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_009641.5332272.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_013450.8614421.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_007793.3914279.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_003923.1003749.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002745.1124361.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_009782.5559369.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002951.3237708.p0 Protein 2e-51 53
TEH_11180 YP_004886609.1 OmpR family two-component response regulator HE999704.1.gene2815. Protein 2e-47 52
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_012469.1.7686381. Protein 2e-40 47
TEH_11180 YP_004886609.1 OmpR family two-component response regulator AE000516.2.gene3505. Protein 3e-36 46
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP004022.1.gene3215. Protein 8e-37 46
TEH_11180 YP_004886609.1 OmpR family two-component response regulator AE016830.1.gene1681. Protein 1e-44 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002952.2859858.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_007622.3794948.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_003923.1003417.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_013450.8614146.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002951.3238224.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_007793.3914065.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002758.1121390.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_010079.5776364.p0 Protein 3e-36 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator BAC0533 Protein 2e-32 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP000647.1.gene4257. Protein 2e-32 45
TEH_11180 YP_004886609.1 OmpR family two-component response regulator AF155139.2.orf0.gene Protein 4e-35 44
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_010410.6002989.p0 Protein 1e-30 44
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_010400.5986590.p0 Protein 1e-30 44
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_011595.7057856.p0 Protein 1e-30 44
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP001138.1.gene4273. Protein 5e-32 44
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002695.1.915041.p Protein 9e-32 44
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP000034.1.gene3834. Protein 9e-32 44
TEH_11180 YP_004886609.1 OmpR family two-component response regulator HE999704.1.gene1528. Protein 1e-31 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator AF130997.1.orf0.gene Protein 2e-38 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator DQ212986.1.gene4.p01 Protein 7e-40 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator AM180355.1.gene1830. Protein 7e-41 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator FJ349556.1.orf0.gene Protein 1e-38 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator AE015929.1.gene1106. Protein 3e-30 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_014475.1.orf0.gen Protein 2e-38 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_005054.2598277.p0 Protein 2e-38 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator AF162694.1.orf4.gene Protein 3e-33 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator NC_002695.1.916589.p Protein 1e-30 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP001138.1.gene2239. Protein 5e-30 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator BAC0039 Protein 2e-30 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator BAC0596 Protein 5e-30 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP000034.1.gene2186. Protein 2e-30 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP001485.1.gene721.p Protein 1e-27 41
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP004022.1.gene1676. Protein 3e-26 41
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP001918.1.gene3444. Protein 3e-29 41
TEH_11180 YP_004886609.1 OmpR family two-component response regulator CP000647.1.gene2531. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TEH_11180 YP_004886609.1 OmpR family two-component response regulator VFG1386 Protein 8e-37 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator VFG1389 Protein 2e-30 43
TEH_11180 YP_004886609.1 OmpR family two-component response regulator VFG1563 Protein 2e-34 42
TEH_11180 YP_004886609.1 OmpR family two-component response regulator VFG1702 Protein 2e-34 42