Gene Information

Name : yceD (SCAT_2465)
Accession : YP_004911981.1
Strain : Streptomyces cattleya NRRL 8057
Genome accession: NC_016111
Putative virulence/resistance : Resistance
Product : stress adaptation protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2602763 - 2603338 bp
Length : 576 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf : factor

DNA sequence :
ATGCCTGTAAGCCTGTCCAAGGGCGGCAACATCTCGCTGACCAAGGAGGCCCCCGGCCTGACCGCGGTCACCGTCGGCCT
GGGCTGGGACGTGCGCACCACCACCGGCACCGACTTCGACCTCGACGCCAGCGCGATCGCGGTCGACGCCACCGGGCGGG
TCCACTCCGACCAGCACTTCGTCTTCTTCAACAACCGCTCCACGCCGGACCGCACCATCGTGCACAGCGGCGACAACCTC
ACCGGCGCCGGCGACGGCGACGACGAGGAGATCAAGGTCGACCTGGCCGGGCTGCCGGCCGCCGTGGCCAAGGTGGTCTT
CCCGGTCTCCATCTACGACGCCGGCTCCCGCGGGCAGAACTTCGGCCAGGTCCGCAACGCCTACATACGCGTGGTCAACC
AGGCCGACGGCGCCGAGATCGCCCGCTACGACCTCAGCGAGGACGCCGCCACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGTTACGCCTCAGGGCTCGCCGGGATCGCCCAGGACTT
CGGGGTCAACGTGTGA

Protein sequence :
MPVSLSKGGNISLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVDATGRVHSDQHFVFFNNRSTPDRTIVHSGDNL
TGAGDGDDEEIKVDLAGLPAAVAKVVFPVSIYDAGSRGQNFGQVRNAYIRVVNQADGAEIARYDLSEDAATETAMVFGEL
YRNGAEWKFRAVGQGYASGLAGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-58 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-58 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-58 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 62
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-57 61
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-56 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-56 58
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-31 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_004911981.1 stress adaptation protein BAC0390 Protein 2e-57 62
yceD YP_004911981.1 stress adaptation protein BAC0389 Protein 3e-55 58