Gene Information

Name : Sfla_2350 (Sfla_2350)
Accession : YP_004923296.1
Strain : Streptomyces flavogriseus ATCC 33331
Genome accession: NC_016114
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2804372 - 2805058 bp
Length : 687 bp
Strand : +
Note : KEGG: sgr:SGR_2635 two-component system response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing protein

DNA sequence :
ATGGCCGACGTGCCTTTCCTGTTGCTGATCGAGGACGACGACGCCATCCGTACAGCCCTCGAACTCTCGCTGTCACGCCA
GGGCCACCGTGTGGCCACCGCGGCGACGGGAGAGGACGGCCTGGAGCTGCTCCGGGAGCAGCGGCCGGACCTGGTCGTGC
TGGACGTGATGCTGCCCGGGATCGACGGTTTCGAGGTCTGCCGGCGGATCCGGCGCACCGACCAGCTGCCGATCATTCTG
CTGACCGCGCGCAGCGACGACATCGACGTCGTGGTGGGACTGGAGTCCGGCGCGGACGACTACGTCGTGAAACCCGTGCA
GGGCCGGGTGCTCGACGCCCGTATCCGCGCGGTGCTGCGCCGCGGGGAGAGGGAGTCCACGGACTCGGCGACGTTCGGAA
GTGTCGTCATCGACCGTTCGGCGATGACCGTCACCAAGAACGGGGAGGACCTGCAGCTCACGCCGACCGAGTTGCGGCTC
CTGCTCGAACTGAGCCGCCGTCCCGGACAGGCCCTGTCCCGGCAGCAGTTGCTGCGCCTCGTGTGGGAGCACGACTATCT
CGGTGACTCCCGGCTGGTGGACGCCTGTGTGCAGCGGCTGCGGGCGAAGGTGGAGGACGTGCCCTCGTCGCCGACCCTGA
TCCGCACCGTGCGCGGTGTCGGTTACCGGCTGGACTCGCCTCAGTGA

Protein sequence :
MADVPFLLLIEDDDAIRTALELSLSRQGHRVATAATGEDGLELLREQRPDLVVLDVMLPGIDGFEVCRRIRRTDQLPIIL
LTARSDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGERESTDSATFGSVVIDRSAMTVTKNGEDLQLTPTELRL
LLELSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDSPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-35 48
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-38 44
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-38 43
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-32 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-22 42
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-27 41
Sfla_2350 YP_004923296.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-23 41