Gene Information

Name : Sfla_4457 (Sfla_4457)
Accession : YP_004925379.1
Strain : Streptomyces flavogriseus ATCC 33331
Genome accession: NC_016114
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 5156125 - 5156700 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: sgr:SGR_5133 TerD-family protein

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTCTCGCTGACCAAGGCCGCGCCGAACCTGACCGCGGTCATCGTCGGTCT
GGGCTGGGATGCCCGGACGACCACCGGCGGTGACTTCGACCTCGACGCCAGCGCTCTGCTGACGAACGCCGAGGGCAAGG
TCGGCAGCGACGGGAATTTCGTCTTCTTCAACAACCTCAAGAGCCCCGACGGCTCCGTCGAGCACACCGGCGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAAGGTCAACCTCTCGGGCGTCCCCGCCGACGTCGACAAGATCGTTTT
CCCGGTCTCGATCTACGAGGCCGAGAGCCGTCAGCAGAGCTTCGGCCAGGTCCGCAACGCGTACATCCGCGTGGTGAACC
AGGCGGACAACAGTGAGCTCGCCCGCTACGACCTGAGCGAGGACGCCTCGACGGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGCAACGGCGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGGTACGCCTCGGGTCTGCGCGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKAAPNLTAVIVGLGWDARTTTGGDFDLDASALLTNAEGKVGSDGNFVFFNNLKSPDGSVEHTGDNL
TGEGEGDDEVIKVNLSGVPADVDKIVFPVSIYEAESRQQSFGQVRNAYIRVVNQADNSELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-62 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-61 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-61 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-61 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-57 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 63
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-57 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-29 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-29 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_4457 YP_004925379.1 stress protein BAC0389 Protein 2e-61 65
Sfla_4457 YP_004925379.1 stress protein BAC0390 Protein 1e-58 63
Sfla_4457 YP_004925379.1 stress protein BAC0392 Protein 3e-28 43