Gene Information

Name : Sfla_4458 (Sfla_4458)
Accession : YP_004925380.1
Strain : Streptomyces flavogriseus ATCC 33331
Genome accession: NC_016114
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 5156852 - 5157427 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: sgr:SGR_5134 TerD-family protein

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAATGTCTCCCTCTCCAAGGCCGCACCCAATCTCACGCAGGTGCTGGTCGGGCT
CGGCTGGGACGCACGATCCACGACGGGAGCCGACTTCGACCTGGACGCCAGCGCACTGCTGTGCCAGTCGGGCCGGGTCC
TCGGCGACGAGTGGTTCGTGTTCTACAACAACCTCACCAGCCCCGACGGCTCCGTCGAGCACACCGGTGACAACCTCACG
GGGGAGGGCGACGGCGACGACGAGTCCGTCATCGTGAACCTCACGCAGGTGCCGGCGCACTGCGACAAGATCCTTTTCCC
GGTCTCCATCCATGAAGCCGACAATCGTGGGCAGACATTCGGTCAGGTCAGCAATGCCTTCATCCGCGTGGTCAACCAGG
CGGACGGGCAGGAACTGGCACGGTACGACCTCACCGAGGACGCGTCGACGGAGACGGCGATGATCTTCGGCGAGCTCTAC
CGATATGGCGGGGAGTGGAAATTCCGTGCAGTCGGACAGGGGTACGCGTCCGGGCTCCGCGGCATCGCTCTAGACTTCGG
GGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVLVGLGWDARSTTGADFDLDASALLCQSGRVLGDEWFVFYNNLTSPDGSVEHTGDNLT
GEGDGDDESVIVNLTQVPAHCDKILFPVSIHEADNRGQTFGQVSNAFIRVVNQADGQELARYDLTEDASTETAMIFGELY
RYGGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 70
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 70
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-58 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-60 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-54 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_4458 YP_004925380.1 stress protein BAC0389 Protein 2e-57 68
Sfla_4458 YP_004925380.1 stress protein BAC0390 Protein 5e-58 64
Sfla_4458 YP_004925380.1 stress protein BAC0392 Protein 2e-25 43