Gene Information

Name : Sfla_5506 (Sfla_5506)
Accession : YP_004926419.1
Strain : Streptomyces flavogriseus ATCC 33331
Genome accession: NC_016114
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 6323666 - 6324241 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: sgr:SGR_341 TerD-family protein

DNA sequence :
GTGGGAGTCAGCCTGTCCAAGGGCGGAAACGTATCGCTCAGCAAGGAGGCCCCCGGCCTCACCGCCGTGACGGTCGGGCT
CGGCTGGGACGTGCGCACCACCACCGGTGCCGATCACGACCTCGACGCCAGCGCCCTGCTGTGCACCGAAGCCGGCAAGG
TGGTCTCCGACCGGCACTTCGTCTTCTACAACAACCTCAACAGCCCCGACGGTTCGGTCCAGCACACCGGCGACAACCTC
ACCGGCGAGGGCGAGGGCGACGACGAGTCCATCAACGTGGACCTGTCGTCGGTGCCCGCCGAGGTGTCGAAGATCGTCTT
CCCGGTCTCCATCCATGACGCGACGGCGCGCGGCCAGAGCTTCGGCCAGGTCCGCAACGCCTTCATCCGGGTGATCAACC
GGTCCGACAACGTCGAACTGGCCCGCTACGACCTGAGCGAGGACGCCTCGACCGAGACCGCGATGGTCTTCGGCGAGCTC
TACCGTCACGGCAGCGAGTGGAAGTTCCGCGCGGTGGGCCAGGGATACGCCTCCGGTCTGGCAGGTATCGCCGCCGACTT
CGGCGTCAACATCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLTAVTVGLGWDVRTTTGADHDLDASALLCTEAGKVVSDRHFVFYNNLNSPDGSVQHTGDNL
TGEGEGDDESINVDLSSVPAEVSKIVFPVSIHDATARGQSFGQVRNAFIRVINRSDNVELARYDLSEDASTETAMVFGEL
YRHGSEWKFRAVGQGYASGLAGIAADFGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-60 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-59 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-60 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-56 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-57 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-57 63
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-30 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfla_5506 YP_004926419.1 stress protein BAC0389 Protein 7e-59 67
Sfla_5506 YP_004926419.1 stress protein BAC0390 Protein 1e-60 65
Sfla_5506 YP_004926419.1 stress protein BAC0392 Protein 3e-26 43