Gene Information

Name : DSC_03840 (DSC_03840)
Accession : YP_004929462.1
Strain : Pseudoxanthomonas spadix BD-a59
Genome accession: NC_016147
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 629325 - 630005 bp
Length : 681 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAACTTCTGGTTGTCGAAGACGAGCACAAGACTGCGGACTACGTACGCCAAGGGCTTACCGAGGCCGGGTTCGTTGT
CGACTTGGCGCGCGATGGGCCCGATGGCCTGCACTTGGCCACGACCGAGCACTACGACCTGATCGTGCTCGACGTCATGC
TCCCGGGCATTGATGGGCGGAAGGTCCTGCAGTCCATTCGCGCCACCGGCAACCAGGTTCCGGTGCTTTTCCTGACCGCC
CGCAGCAGTGTCGACGATCGCGTCCAAGGGCTGGAACTGGGGGCCGATGACTACCTGATCAAACCATTCGCGTTCTCGGA
GCTGCTTGCACGCGTGCGGACCCTGTTGCGCAGGGGAGGCTCGCCCGCGCCTCACGACCGCATTCAGATCGCCGATCTGG
AGCTGGACCTTGCGCGCCGGCGCGCCATCCGGGCCGGGCACCGTATCACCCTGACCAGCAAGGAATTCGCCTTGCTCGAA
CTACTGGCACGACGCCAAGGTGAAGTGCTGCCGCGTTCGCTGATCGCCTCGCAAGTCTGGGACATGAATTTCGACAGCGA
CACCAATGTCATCGACGTCGCAATCCGGCGGTTGCGCGCCAAGATAGACGACAGCTACGAGCCCAAGCTCATCCAGACCG
TGCGCGGCATGGGGTACACGCTGGACATCCCGGATGCCTGA

Protein sequence :
MKLLVVEDEHKTADYVRQGLTEAGFVVDLARDGPDGLHLATTEHYDLIVLDVMLPGIDGRKVLQSIRATGNQVPVLFLTA
RSSVDDRVQGLELGADDYLIKPFAFSELLARVRTLLRRGGSPAPHDRIQIADLELDLARRRAIRAGHRITLTSKEFALLE
LLARRQGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDSYEPKLIQTVRGMGYTLDIPDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-62 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-62 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-65 70
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-69 69
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-67 66
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator BAC0111 Protein 5e-72 65
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-64 62
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator BAC0125 Protein 7e-65 62
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-64 61
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-37 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 1e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 9e-36 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 1e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 1e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 1e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 1e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 1e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 1e-35 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 2e-30 42
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 6e-28 41
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 3e-33 41
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 1e-30 41
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator NC_012469.1.7686381. Protein 1e-31 41
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator VFG0596 Protein 4e-63 61
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-38 49
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-42 45
DSC_03840 YP_004929462.1 two component heavy metal response transcriptional regulator VFG1386 Protein 8e-37 41