Gene Information

Name : Tlie_0036 (Tlie_0036)
Accession : YP_004931879.1
Strain : Thermovirga lienii DSM 17291
Genome accession: NC_016148
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 39980 - 40699 bp
Length : 720 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: aco:Amico_168

DNA sequence :
ATGCAATCTGAGCGCATCCTTGTGGTGGAGGATGAGGAGGCTCTCTCCGACATCTTGTCAGATGCCCTCAAGCGCCACGG
GTACAAAGTAGAAAAGGCCTTCGATGGAGATACGGGACTTGAAATGGCAGAAAACCTCCTGCCCGACCTCATCATATTGG
ATATAATGCTCCCTAAAATGGACGGCTGGGAAGTGTGCCGAAGATTGAAAGGGAATCCAAAGACCTCTAACATTCCCATA
ATCCTGCTGACTGCCAGGAGGGACGAACGAGACGTCGTGGCTGGACTAGATTTGGGAGCCGATGACTACATACGTAAGCC
CTTCTCATTGATAGAGCTCATGGCAAGGGTCAGAAGCGTACTGAGAAGGAGCAAGACCAAAAGCACAGAAAGTCCTTCTA
TTCAAATAGGACCTCTGGAAATGGATTTTGAAAAACAGGTAGTAACCCTTGATGGAAAGACATTGGACTTGAGCCCTACG
GAATACCACCTTTTAGAGATCCTGGCCCAAAACCCTGGCCGGGTCCTATCCCGAGAGGAGCTTCTGGCCAAGGGATGGGG
CTACTATCTTGGAGACAGCAGGACCGTGGACGTTCACATTTCAAGGTTGAGAAGGAAGCTAGAGAAAGATCCTGAAAACC
CAAAGATCCTGCATACCGTTCGGGGAAGGGGATATATGATCAAGTGGGAGGAAAAAGCGCATGAGAACTCTCAAAGGTAA

Protein sequence :
MQSERILVVEDEEALSDILSDALKRHGYKVEKAFDGDTGLEMAENLLPDLIILDIMLPKMDGWEVCRRLKGNPKTSNIPI
ILLTARRDERDVVAGLDLGADDYIRKPFSLIELMARVRSVLRRSKTKSTESPSIQIGPLEMDFEKQVVTLDGKTLDLSPT
EYHLLEILAQNPGRVLSREELLAKGWGYYLGDSRTVDVHISRLRRKLEKDPENPKILHTVRGRGYMIKWEEKAHENSQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-25 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-36 48
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-36 48
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-36 47
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-35 46
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-31 46
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-34 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 7e-28 43
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-23 43
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-29 43
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-34 42
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-29 42
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 2e-32 42
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 6e-34 42
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-29 42
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-32 42
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family BAC0308 Protein 4e-30 41
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family BAC0111 Protein 5e-29 41
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-28 41
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 5e-29 41
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-28 41
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family BAC0039 Protein 5e-29 41
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 4e-29 41
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family VFG1390 Protein 8e-36 44
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family VFG1389 Protein 5e-31 43
Tlie_0036 YP_004931879.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-25 41