Gene Information

Name : soxS (EcWSU1_00284)
Accession : YP_004950145.1
Strain : Enterobacter cloacae EcWSU1
Genome accession: NC_016514
Putative virulence/resistance : Resistance
Product : regulatory protein soxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 301078 - 301428 bp
Length : 351 bp
Strand : -
Note : -

DNA sequence :
TTGTATCTACAGAGGGGCAACCTTATGTCGCATCAGCAAATTATTCAGACACTTATTGAATGGATTGATGAACATATCGA
CCAACCGTTGAACATTGATGTGGTCGCTAAAAAATCCGGCTATTCGAAATGGTATTTACAGAGAATGTTCCGTACCGTTA
TGCACCAGACGCTGGGTGAGTACATTCGTCAGCGCAGACTGCTGCTGGCGGCGCAGGCCTTACGCTCAACGCAGCGGCCC
ATTTTTGATATCGCGATGGATCTGGGTTATGTGTCGCAACAAACCTTTTCCCGCGTGTTTCGCCGCGAGTTTGACCGTAC
ACCGAGCGACTATCGCCACCAGTTGAATTAA

Protein sequence :
MYLQRGNLMSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVMHQTLGEYIRQRRLLLAAQALRSTQRP
IFDIAMDLGYVSQQTFSRVFRREFDRTPSDYRHQLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 6e-38 95
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-15 47
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-15 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_004950145.1 regulatory protein soxS CP001918.1.gene327.p Protein 5e-40 100
soxS YP_004950145.1 regulatory protein soxS CP001138.1.gene4488. Protein 2e-38 95
soxS YP_004950145.1 regulatory protein soxS CP000647.1.gene4499. Protein 6e-39 93
soxS YP_004950145.1 regulatory protein soxS BAC0371 Protein 3e-37 90
soxS YP_004950145.1 regulatory protein soxS NC_002695.1.914293.p Protein 3e-37 90
soxS YP_004950145.1 regulatory protein soxS CP000034.1.gene4505. Protein 5e-37 89
soxS YP_004950145.1 regulatory protein soxS CP001138.1.gene612.p Protein 1e-19 49
soxS YP_004950145.1 regulatory protein soxS NC_010558.1.6276025. Protein 9e-16 47
soxS YP_004950145.1 regulatory protein soxS CP000647.1.gene1624. Protein 6e-16 43
soxS YP_004950145.1 regulatory protein soxS CP001918.1.gene2033. Protein 3e-16 43
soxS YP_004950145.1 regulatory protein soxS CP001138.1.gene1637. Protein 2e-16 42
soxS YP_004950145.1 regulatory protein soxS BAC0560 Protein 2e-16 42
soxS YP_004950145.1 regulatory protein soxS NC_002695.1.917339.p Protein 2e-16 42
soxS YP_004950145.1 regulatory protein soxS CP000034.1.gene1596. Protein 2e-16 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_004950145.1 regulatory protein soxS VFG0585 Protein 2e-38 95
soxS YP_004950145.1 regulatory protein soxS VFG1038 Protein 8e-16 47