Gene Information

Name : BYI23_E000790 (BYI23_E000790)
Accession : YP_004980027.1
Strain :
Genome accession: NC_016591
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 78533 - 78886 bp
Length : 354 bp
Strand : -
Note : -

DNA sequence :
ATGCCTGAAGTGATCGCGCTGCCGGCAGGTACGCGCGTTTGGCTCGTGGCCGGCGTGACAGATATGCGCTGCGGCTTCCA
GGGGCTGGCCGCGAAAGTGCAGACAGCGCTCGAAGAAAATCCGCTGGGTGGCAACGTATTCATCTTCCGCGGTCGCCGCG
GCGATCTCGTGAAGCTGCTTTGGGCGACCGACGATGGACTCTGGCTGCTCGCAAAACGATTGGAGCGAGGCCGGTTTATC
TGGCCCCAGGCCGACGGTGGAAAGATCCATCTGACGAGCGCACAGTTGTCGATGCTCCTCGAAGGCATCGACTGGCGACA
CCCGCAACGTACCGCTGCTTTGTCGATGTTGTAA

Protein sequence :
MPEVIALPAGTRVWLVAGVTDMRCGFQGLAAKVQTALEENPLGGNVFIFRGRRGDLVKLLWATDDGLWLLAKRLERGRFI
WPQADGGKIHLTSAQLSMLLEGIDWRHPQRTAALSML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 8e-27 70
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-34 69
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-35 69
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-35 69
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-35 69
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-35 69
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-35 69
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-35 69
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-35 69
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-35 69
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-34 69
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-35 68
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-35 68
unnamed AAL08461.1 unknown Not tested SRL Protein 9e-35 67
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-35 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-35 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-35 67
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-31 67
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 9e-36 66
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 9e-36 66
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-31 60
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-31 60
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-30 59
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-30 59
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-31 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_E000790 YP_004980027.1 IS66 Orf2 family protein VFG1517 Protein 3e-27 70
BYI23_E000790 YP_004980027.1 IS66 Orf2 family protein VFG0792 Protein 2e-35 69
BYI23_E000790 YP_004980027.1 IS66 Orf2 family protein VFG1709 Protein 2e-35 69
BYI23_E000790 YP_004980027.1 IS66 Orf2 family protein VFG1698 Protein 1e-35 68
BYI23_E000790 YP_004980027.1 IS66 Orf2 family protein VFG1052 Protein 4e-35 67
BYI23_E000790 YP_004980027.1 IS66 Orf2 family protein VFG1665 Protein 2e-35 67
BYI23_E000790 YP_004980027.1 IS66 Orf2 family protein VFG1737 Protein 1e-31 59