Gene Information

Name : GTCCBUS3UF5_24400 (GTCCBUS3UF5_24400)
Accession : YP_004982843.1
Strain : Geobacillus thermoleovorans CCB_US3_UF5
Genome accession: NC_016593
Putative virulence/resistance : Virulence
Product : Two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2253667 - 2254341 bp
Length : 675 bp
Strand : -
Note : similar to Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain COG0745; similar to Two-component response regulator of root UniRef RepID=C0Z5X8_BREBN

DNA sequence :
ATGAACGGACGTATTTTATTGATTGAAGATGAAGCCGGGCTCGCCCGGTTTTTGGAGCTTGATTTAAAGCACGAAGGCTT
TGACGTGCATGTATGCGCCGATGGACGCGAAGGGCTCGAGCTCGCTCTTTCGGAGCAGTGGGATCTCATTTTGCTTGATG
TGATGCTGCCGCGTTTAAATGGCATGGAAGTATGCCGCCGCATCCGGGCGGCGAAATCGACGCCGATCATCATGATCACA
GCGCGCGACAGCGTGTTTGACCGCGTCATGGGGCTCGATAACGGGGCCGATGACTACATCGTCAAACCGTTTGCCATTGA
AGAGCTGCTCGCCCGCATCCGCGCCTTGTTCCGCCGCGTTCATCCGGAAGCGAACGCCCAAGTGTTGACGTTTAAAGATT
TAGTCGTTGACGTGCAGGCGCGCACAGTGAAAAAAGGAGACGAATTTATTGAGCTGACGAAGCGCGAATACGATTTGCTC
GTCGCCTTTATGCAAAACATCAATGTTGTCTTGACGCGTGATGCGCTCCTTGACAAAGTGTGGGGGTTCGACGCCGAGGT
TGAGACGAACGTCGTTGACGTCTACGTTCGCTATTTGCGGCAAAAGCTTGACGAACACGATAAAGAGCGGTATATCCAAA
CGGTGCGCGGCACGGGATATGTGATGCGGCCATGA

Protein sequence :
MNGRILLIEDEAGLARFLELDLKHEGFDVHVCADGREGLELALSEQWDLILLDVMLPRLNGMEVCRRIRAAKSTPIIMIT
ARDSVFDRVMGLDNGADDYIVKPFAIEELLARIRALFRRVHPEANAQVLTFKDLVVDVQARTVKKGDEFIELTKREYDLL
VAFMQNINVVLTRDALLDKVWGFDAEVETNVVDVYVRYLRQKLDEHDKERYIQTVRGTGYVMRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-36 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator HE999704.1.gene1528. Protein 3e-70 66
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_002951.3238224.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_007793.3914065.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_002758.1121390.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_010079.5776364.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_002952.2859858.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_007622.3794948.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator AE015929.1.gene1106. Protein 1e-52 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_003923.1003417.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_013450.8614146.p0 Protein 2e-56 55
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator BAC0125 Protein 1e-37 44
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator BAC0308 Protein 8e-38 44
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator AE000516.2.gene3505. Protein 4e-38 44
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator BAC0197 Protein 2e-35 43
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator CP001485.1.gene721.p Protein 8e-33 42
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_012469.1.7685629. Protein 8e-40 42
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator BAC0083 Protein 6e-38 42
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator NC_012469.1.7686381. Protein 5e-44 41
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator HE999704.1.gene2815. Protein 9e-39 41
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator BAC0111 Protein 6e-37 41
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator BAC0638 Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator VFG1390 Protein 7e-48 48
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator VFG0596 Protein 2e-35 43
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator VFG1389 Protein 2e-39 43
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator VFG1563 Protein 4e-36 42
GTCCBUS3UF5_24400 YP_004982843.1 Two-component response regulator VFG1702 Protein 2e-36 42