Gene Information

Name : GTCCBUS3UF5_38910 (GTCCBUS3UF5_38910)
Accession : YP_004984289.1
Strain : Geobacillus thermoleovorans CCB_US3_UF5
Genome accession: NC_016593
Putative virulence/resistance : Resistance
Product : transcriptional regulatory protein walR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3572122 - 3572844 bp
Length : 723 bp
Strand : -
Note : similar to Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain COG0745; similar to Transcriptional regulatory protein walR of root UniRef RepID=WALR_STAA1

DNA sequence :
GTGAGCGAGATGGAAAAACGCATTTTAGTCGTTGATGATGAAAAACCGATTGCCGATATTTTGCAATTTAATTTGCAAAA
AGAAGGATATGAAGTCATTTGCGCCTACGACGGCGAAGAAGCGCTGCAAAAAGTTGAAGAAACGATGCCGGACTTGATTT
TATTGGATATTATGTTGCCGTTAAAAGATGGCATGGAAGTATGCCGTGAAGTGCGGAAAAAGTATGATATGCCGATCATT
ATGCTGACAGCGAAAGATTCCGAGATTGATAAAGTGCTTGGGTTGGAGCTTGGTGCGGACGATTATGTGACAAAGCCGTT
CAGCACGCGCGAGCTCCTGGCGCGGGTGAAGGCAAACTTGCGCCGCCATGCGCAAACGGCCAACCAAGAAGAAGGAGAAA
ACGAAACAAATGAAATCGTCATTGGCCCGCTCGTCATCCGTCCGGACGCGTATGTCGTGCAAAAGCGGGGGGAAACAATT
GAACTGACCCACCGCGAATTTGAACTGCTTCATTACTTAGCGAAGCATATCGGCCAAGTGATGACGCGCGAGCATTTGCT
GCAAACCGTCTGGGGCTACGATTACTATGGCGATGTGCGCACCGTGGACGTGACGGTAAGACGTCTGCGTGAAAAAATTG
AGGACAACCCTTCCCACCCGAATTGGATCGTCACAAGACGGGGAGTCGGCTATTACTTGCGCAATCCGGAACAGGAGTCA
TGA

Protein sequence :
MSEMEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEETMPDLILLDIMLPLKDGMEVCREVRKKYDMPII
MLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHAQTANQEEGENETNEIVIGPLVIRPDAYVVQKRGETI
ELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYYGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-20 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-27 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_012469.1.7685629. Protein 1e-56 67
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002952.2859905.p0 Protein 4e-48 56
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_009641.5332272.p0 Protein 4e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_013450.8614421.p0 Protein 4e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_007793.3914279.p0 Protein 4e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_007622.3794472.p0 Protein 3e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002745.1124361.p0 Protein 4e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_009782.5559369.p0 Protein 4e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002951.3237708.p0 Protein 4e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_003923.1003749.p0 Protein 3e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002758.1121668.p0 Protein 4e-48 55
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR HE999704.1.gene2815. Protein 3e-39 53
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_012469.1.7686381. Protein 2e-36 50
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR FJ349556.1.orf0.gene Protein 5e-34 47
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AE016830.1.gene1681. Protein 9e-39 46
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AM180355.1.gene1830. Protein 3e-34 45
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AF155139.2.orf0.gene Protein 8e-30 45
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR HE999704.1.gene1528. Protein 1e-24 44
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AE000516.2.gene3505. Protein 8e-29 44
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR CP001918.1.gene5135. Protein 1e-28 44
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AF162694.1.orf4.gene Protein 2e-29 43
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR DQ212986.1.gene4.p01 Protein 2e-33 43
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002695.1.915041.p Protein 3e-33 43
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR CP000034.1.gene3834. Protein 3e-33 43
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR CP004022.1.gene3215. Protein 1e-32 43
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002952.2859858.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_007622.3794948.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_003923.1003417.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_013450.8614146.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002951.3238224.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_007793.3914065.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_002758.1121390.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_010079.5776364.p0 Protein 3e-29 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_014475.1.orf0.gen Protein 6e-31 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR NC_005054.2598277.p0 Protein 6e-31 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AF130997.1.orf0.gene Protein 7e-30 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR BAC0533 Protein 3e-32 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR CP000647.1.gene4257. Protein 3e-32 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR CP001138.1.gene4273. Protein 2e-32 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AF310956.2.orf0.gene Protein 2e-20 41
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR BAC0125 Protein 5e-24 41
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR AE015929.1.gene1106. Protein 5e-24 41
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR EU250284.1.orf4.gene Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR VFG1389 Protein 1e-23 44
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR VFG1390 Protein 9e-27 42
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR VFG1702 Protein 6e-28 41
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR VFG1563 Protein 6e-28 41
GTCCBUS3UF5_38910 YP_004984289.1 transcriptional regulatory protein walR VFG1386 Protein 7e-25 41