Gene Information

Name : Oweho_1712 (Oweho_1712)
Accession : YP_004989345.1
Strain : Owenweeksia hongkongensis DSM 17368
Genome accession: NC_016599
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1862933 - 1863634 bp
Length : 702 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGAAAAGAGTATTAGTAATAGAAGACGACCCAGACATCATCGAGCTGATAAGCCTCCACCTTACCGATTTAAACTGTGC
TGTAGAAAAGCAGATGAACGGATTAGAAGGTTTTAATGCAGCCCAAGCTTCTTCTTTTGACCTTATCATTTTAGACCTGA
TGCTTCCGGGTATGGATGGAATTGCGATTTGTCAAAAACTTAGGGCACTGGACAATTTCACTCCTATACTTATGCTTACC
GCAAAAGCTGAAGAATTTGACAAAGTATTGGGTTTAGAATCAGGTGCCGATGATTACCTCACAAAGCCCTTTGGAATTAG
GGAGTTTATAGCTAGGGTAAAAGCTATTCTGCGCAGGCAGGAAATTCATCAAGGGCAATCGGAAGAAAAACAAGTCTCAG
AAATCAAACGCGGCAATCTTTATATTAATAGGAATAATCGAAAGGTAACTTTAGAAGGAAACCGAGTAGAACTCACCCCT
AAGGAATTTGACCTCCTCTGCCTGATGGCCGAGAATCCGGGAAGAAGTTTTGACCGCGACCAACTGCTTTCTTCAGTTTG
GGGTTATGAATTTAATGGATACGAACACACAGTAAATTCACACATCAATAGGCTTAGGTCTAAAATTGAAGGAGACCTTT
CCAAACCGCAATACATACTCACCACCTGGGGTGTAGGCTACCGCTTTAATGATGAAATATAA

Protein sequence :
MKRVLVIEDDPDIIELISLHLTDLNCAVEKQMNGLEGFNAAQASSFDLIILDLMLPGMDGIAICQKLRALDNFTPILMLT
AKAEEFDKVLGLESGADDYLTKPFGIREFIARVKAILRRQEIHQGQSEEKQVSEIKRGNLYINRNNRKVTLEGNRVELTP
KEFDLLCLMAENPGRSFDRDQLLSSVWGYEFNGYEHTVNSHINRLRSKIEGDLSKPQYILTTWGVGYRFNDEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-46 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-46 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 2e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 1e-45 45
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 1e-46 44
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 5e-44 44
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 4e-40 43
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-42 43
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 3e-40 42
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 2e-40 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 6e-36 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 1e-38 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 1e-38 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 4e-45 41
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AM180355.1.gene1830. Protein 3e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 3e-46 47
Oweho_1712 YP_004989345.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 3e-46 47