Gene Information

Name : MycrhN_1063 (MycrhN_1063)
Accession : YP_004998904.1
Strain : Mycobacterium rhodesiae NBB3
Genome accession: NC_016604
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1091736 - 1092440 bp
Length : 705 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
GTGCTGATCGCCGACGACGACACCGTCGTGCGTGATGTCGTGCGCCGGTATCTGGAGCGCGACGGCCTCGAGGTGTCGAT
CGCCCACGACGGTAGAGAGGCGCTGCGCCTGCTCGGTTCTCAACGGATCGACGTCGCGGTGCTCGATGTGATGATGCCCG
GCCAGGACGGGCTCACGCTGTGCCGCACGCTGCGGCAGCGCGGCGACTACTCGATTCCGGTGATCCTGCTGACCGCGCTC
GGGGAGGAGGACGACCGGATCGCCGGACTCGAGGCGGGCGCCGACGATTATCTGACCAAACCGTTCAGTCCTCGTGAGCT
CGCGCTGCGGGTGCGGTCGGTGCTGCGCCGTGCGCCTACGCCGTCGGGTCCGATGGCGCTCGACATCACCGTGGGCGATT
TGGCCGTGTCGACGGCTGCGCGGTCGGTGACTGTTGCGGGAGAACCGATTTCGCTGACCAACCGTGAATTCGATCTGCTG
ATGTTCTTCCTGACACACACCGACACCGTGTTCTCGCGTGAGGAACTGCTGAAGCAGGTGTGGCGGTGGGACTTCGGCGA
TCTGTCCACCGTGACGGTGCACGTGAAGCGGTTACGGTCCAAGCTCGGTGCCGCGCATCGGGTGCAGACGGTGTGGGGAC
GCGGGTACCTGTGGGCGGGCGGGGGTACGCCCTCGCGCGAAGAGCGGAAACCGAGTGCCAACTGA

Protein sequence :
MLIADDDTVVRDVVRRYLERDGLEVSIAHDGREALRLLGSQRIDVAVLDVMMPGQDGLTLCRTLRQRGDYSIPVILLTAL
GEEDDRIAGLEAGADDYLTKPFSPRELALRVRSVLRRAPTPSGPMALDITVGDLAVSTAARSVTVAGEPISLTNREFDLL
MFFLTHTDTVFSREELLKQVWRWDFGDLSTVTVHVKRLRSKLGAAHRVQTVWGRGYLWAGGGTPSREERKPSAN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 4e-20 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 4e-20 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 4e-20 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-19 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 4e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 1e-19 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-25 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 4e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 4e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-27 41
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 3e-23 44
MycrhN_1063 YP_004998904.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 2e-23 42