Gene Information

Name : MycrhN_2665 (MycrhN_2665)
Accession : YP_005000461.1
Strain : Mycobacterium rhodesiae NBB3
Genome accession: NC_016604
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2674855 - 2675589 bp
Length : 735 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGCGGGGGGTGCTATCGGGCAAGATTGGGGCCATGGACAGTGGAGCGGCCTCACCCCGGGTGCTCGTGGTCGACGACGA
CCCCGACGTGCTCGCCTCGCTAGAGCGCGGACTGCGGCTGTCCGGTTTCGACGTGTCCACCGCGATCGACGGCGCCGAAG
CGCTGCGCAGCGCGACGGAGACCCGCCCGGACGCGATCGTCCTCGACATCAACATGCCCGTGCTCGACGGTGTCAGCGTG
GTCACCGCGCTGCGTGCGATGGACAACGACGTGCCCGTCTGCGTGTTGTCGGCGCGGAGTTCTGTCGACGACCGGGTGGC
AGGTCTGGAAGCCGGGGCTGACGACTACCTGGTGAAGCCGTTCGTGCTGCAGGAGCTGGTGGCACGCGTCAAGGCGCTGC
TGCGCAGACGCGGTTCGACGGCGACCTTCTCCTCCGAGACCATCCAGGTCGGTCCGCTCGAGGTCGACATTCCCGGTCGG
CGGGCGCGTGTCAACGGCGTCGATGTCGATCTCACCAAACGCGAGTTCGATCTGCTCGCGGTGCTGGCCGAGCACAAGAC
CGCAGTGCTGTCGAGGGCTCAGCTACTGGAGTTGGTGTGGGGATACGACTTCGCCGCCGACACCAACGTCGTCGATGTGT
TCATCGGATATCTGCGCCGCAAGCTCGAAGCCGGCGGCGCACCGCGACTTCTGCACACGGTGCGGGGAGTGGGATTCGTC
CTGAGGACGCAGTAG

Protein sequence :
MRGVLSGKIGAMDSGAASPRVLVVDDDPDVLASLERGLRLSGFDVSTAIDGAEALRSATETRPDAIVLDINMPVLDGVSV
VTALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLQELVARVKALLRRRGSTATFSSETIQVGPLEVDIPGR
RARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGAPRLLHTVRGVGFV
LRTQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-26 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 4e-33 46
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 2e-31 44
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 2e-25 44
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-28 44
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 2e-33 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 2e-32 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 4e-28 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 7e-25 42
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 1e-27 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 1e-27 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 8e-29 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP004022.1.gene3215. Protein 9e-18 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-28 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 9e-29 41
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 1e-86 94
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 4e-43 50
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 2e-37 45
MycrhN_2665 YP_005000461.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 8e-27 41