Gene Information

Name : MycrhN_2767 (MycrhN_2767)
Accession : YP_005000560.1
Strain : Mycobacterium rhodesiae NBB3
Genome accession: NC_016604
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2773859 - 2774653 bp
Length : 795 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGCTCCGGCGCGTCAACCTGTGGCGGTTACCCGGCACGATGAACGCCATGACCAACACATCAGCGCCGTCGGGTGAGGA
TGCGCGCGGCTACCGGGCGCTCGTAGTGGATGACGAGGCCGCGCTGGCTGAGGTCGTGGCCAGCTACCTCACTCGCGAGC
ACTTCGCCACCCGCATCGTCGACAACGGTCCCGACGCGGTCACCGTGGCCCGCGAGTTCGACCCCGACGTGGTGATCCTC
GACCTCGGGCTGCCCGGCATGGACGGGTTAGAGGTATGCCGCACGCTGCGCACCTTCTCCGACGCCTACGTGGTCATGCT
CACCGCCCGCGACACCGAAATGGACACGATCATCGGACTCACCGTCGGCGCCGACGACTACGTCGCCAAACCCTTTAGCC
CGCGCGAATTGGTGGCACGAATCCGGGCGATGCTGCGGCGCCCACGCGTCGCGCCCGACCGCGAGGCCACCCGCCGCGGC
GACGCGCCCGCCCCGCTGCGCTTCGGGCCGCTGCATATCGACGTGGCCGCGCGGGAAGTGTCCCTGCACGATGAGGCGAT
CCTGCTGACCCGCACCGAATTTGACATCCTCGCCGCCCTTTCGGCGCGCCCGGGCGTGGTACTGAGCCGCCGCCAGTTGC
TCGAGACGGTGCGCGAAGGCCCCTGGGTCGGCAACGAACACCTCGTCGATGTCCACATCGGACATGTGCGACGCAAACTG
GGCGACGATCCAGCCGCGCCGCGCTACGTCATCACCGTGCGCGGCGTCGGATACCGGATGGGAAGCGGGCAGTGA

Protein sequence :
MLRRVNLWRLPGTMNAMTNTSAPSGEDARGYRALVVDDEAALAEVVASYLTREHFATRIVDNGPDAVTVAREFDPDVVIL
DLGLPGMDGLEVCRTLRTFSDAYVVMLTARDTEMDTIIGLTVGADDYVAKPFSPRELVARIRAMLRRPRVAPDREATRRG
DAPAPLRFGPLHIDVAAREVSLHDEAILLTRTEFDILAALSARPGVVLSRRQLLETVREGPWVGNEHLVDVHIGHVRRKL
GDDPAAPRYVITVRGVGYRMGSGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-27 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 2e-36 43
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 3e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000034.1.gene3671. Protein 7e-35 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-33 42
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE016830.1.gene1681. Protein 4e-34 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0039 Protein 4e-34 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002695.1.916589.p Protein 3e-34 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0596 Protein 3e-34 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000034.1.gene2186. Protein 4e-34 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP001138.1.gene2239. Protein 3e-34 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 7e-34 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 6e-28 41
MycrhN_2767 YP_005000560.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 4e-27 41