Gene Information

Name : MycrhN_3337 (MycrhN_3337)
Accession : YP_005001077.1
Strain : Mycobacterium rhodesiae NBB3
Genome accession: NC_016604
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3342308 - 3342994 bp
Length : 687 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; manually curated

DNA sequence :
GTGCGAATACTTGTCGTCGACGATGACCGCGCTGTGCGCGAATCGCTGCGTCGCTCGCTTTCCTTCAACGGCTACTCGGT
CGAATTGGCGCAGGACGGTCTCGAAGCCCTCGAAGTGATTGCCAGTGATCGCCCCGACGCCGTCGTCCTCGATGTGATGA
TGCCGCGGCTGGACGGCCTGGAAGTGTGCCGTCAGCTCCGCAGCACCGGTGATGATCTGCCGATCCTCGTCCTGACCGCG
CGCGACTCGGTGTCCGAACGGGTGGCCGGGCTCGACGCGGGCGCCGACGATTATCTACCGAAGCCGTTCGCGCTGGAGGA
ACTACTGGCCCGCATGCGCGCCTTGCTGCGGCGGACGACCCCCGATGATGGGACCGAGTCGCCGGCGATGACGTTCTCCG
ACTTGTCGCTCGATCCGGTCACTCGCGAGGTCACCCGCGGCACCCGCGCGATCAGCCTGACGCGCACGGAGTTCGCACTT
CTCGAGATGCTCATCGCGAATCCGAGGCGCGTGCTCACCCGCAGCCGCATCCTCGAAGAGGTCTGGGGCTTCGACTTTCC
TACGTCCGGCAACGCCCTCGAGGTGTACGTCGGATACCTCCGCCGCAAAACCGAGGCGGAAGGAGAGCCGCGGCTGATCC
ACACCGTGCGTGGGGTGGGTTATGTGCTGCGCGAGACCCCTCCCTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLSFNGYSVELAQDGLEALEVIASDRPDAVVLDVMMPRLDGLEVCRQLRSTGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTTPDDGTESPAMTFSDLSLDPVTREVTRGTRAISLTRTEFAL
LEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 3e-28 45
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 7e-34 44
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 4e-33 44
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 1e-35 44
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 3e-38 43
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 3e-34 43
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 4e-33 42
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 1e-30 41
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain U82965.2.orf14.gene. Protein 4e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 4e-88 93
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 6e-43 51
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 1e-43 47
MycrhN_3337 YP_005001077.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 7e-33 41