Gene Information

Name : Niako_6386 (Niako_6386)
Accession : YP_005012013.1
Strain : Niastella koreensis GR20-10
Genome accession: NC_016609
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7879075 - 7879764 bp
Length : 690 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cpi:Cpin_1247

DNA sequence :
ATGAAGATCCTTTTGGTGGAAGACGAGGCAGCATTGGCCAGTATGCTGAACAAAGGGCTGAAGGAGGCCGGGTACGAAGT
AACGGTGGCGCCCGATGGCCTTATTGGACATGAAATGGCCATAAAAAACCAGTTTGATGTGATGGTCCTGGACATAATGC
TGCCGGGCCTGAATGGTATTCAATTATGCAAACAGATACGCCGCCAGCAAATTGATACACCCATCCTGATGCTGACAGCA
CTGGGCACTACCGAAAATATTGTGGCCGGCCTCGACAGTGGCGCGGATGATTACCTGGTTAAACCTTTTCATTTTGCTGA
ACTGGAAGCCCGGCTGCGAACGCTGATACGCCGTAAATCGGCGGGAAATGCCATTCAACCCGAGGTGCTGCAAATAGGAA
ATCTTACCCTGAACATCAATACCCGCTCAGCCAGCCTGAATGGCGATCCTGTTCCCCTCACCGCAACAGAATATCGCCTG
CTTGAATTTATGATGCATAACCGCGGCCGCGTGTTGAGCCGGATGGAGCTGCTGGAAAATGTGTGGGGAATAGATTTTAA
CATGAGCACCAATGTGGTGGATGTATATGTGAATTACCTGCGCAAAAAAATAGATACCAATCCGGCACAGAAACTTATTC
ATACAATGATAGGGATGGGCTACATTCTTAAAGAAGATAAAAAAAGCTAA

Protein sequence :
MKILLVEDEAALASMLNKGLKEAGYEVTVAPDGLIGHEMAIKNQFDVMVLDIMLPGLNGIQLCKQIRRQQIDTPILMLTA
LGTTENIVAGLDSGADDYLVKPFHFAELEARLRTLIRRKSAGNAIQPEVLQIGNLTLNINTRSASLNGDPVPLTATEYRL
LEFMMHNRGRVLSRMELLENVWGIDFNMSTNVVDVYVNYLRKKIDTNPAQKLIHTMIGMGYILKEDKKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family BAC0111 Protein 9e-46 46
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family BAC0125 Protein 4e-44 45
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-37 45
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-41 45
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-41 45
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family BAC0308 Protein 5e-38 43
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-43 42
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family BAC0083 Protein 3e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-49 44
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-43 43
Niako_6386 YP_005012013.1 two component transcriptional regulator, winged helix family VFG0596 Protein 5e-37 42