Gene Information

Name : KOX_09740 (KOX_09740)
Accession : YP_005017913.1
Strain : Klebsiella oxytoca KCTC 1686
Genome accession: NC_016612
Putative virulence/resistance : Resistance
Product : quaternary ammonium compound-resistance protein QacE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2086144 - 2086473 bp
Length : 330 bp
Strand : -
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGTTTAACCTCGGATTTTTATGGCTGGCGCTGTCTATCGGCTCCGAAATCACCGGCACGTCGATGATCAAAAAGACCAA
CGGCTTCAGCAAGCTGGCGCCGTCGGTGCTGGTGGTATGCGCCTACGGCCTGTGCTACTTCGCCCTCACCCGCGCGATGA
GCACCATTCCGGTCGGCGTCGCCTACTCGCTGTGGTGCGGTTTTGGCATCGTCGGCGTCACGATTTGCTCAATGATCCTT
TATAAGCAAAAACCGGATATCCCGGCTATTCTCGCCATGGTGCTGATCATCTCGGGCGGCATCATTATGAACGTCTTCTC
CAGCATGTAA

Protein sequence :
MFNLGFLWLALSIGSEITGTSMIKKTNGFSKLAPSVLVVCAYGLCYFALTRAMSTIPVGVAYSLWCGFGIVGVTICSMIL
YKQKPDIPAILAMVLIISGGIIMNVFSSM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 4e-40 89
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-15 46
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-14 41
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-14 41
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-14 41
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 5e-14 41
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-14 41
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 41
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-14 41
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 41
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-14 41
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 41
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 5e-14 41
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-14 41
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 41
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 5e-14 41
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-14 41
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-14 41
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-14 41
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-14 41
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-14 41
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-14 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KOX_09740 YP_005017913.1 quaternary ammonium compound-resistance protein QacE BAC0324 Protein 6e-16 45
KOX_09740 YP_005017913.1 quaternary ammonium compound-resistance protein QacE CP004022.1.gene1549. Protein 1e-17 42
KOX_09740 YP_005017913.1 quaternary ammonium compound-resistance protein QacE BAC0323 Protein 1e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KOX_09740 YP_005017913.1 quaternary ammonium compound-resistance protein QacE VFG1586 Protein 2e-40 89
KOX_09740 YP_005017913.1 quaternary ammonium compound-resistance protein QacE VFG1587 Protein 8e-16 46