Gene Information

Name : phoB (AZOLI_3004)
Accession : YP_005040382.1
Strain : Azospirillum lipoferum 4B
Genome accession: NC_016622
Putative virulence/resistance : Virulence
Product : two-component response regulator; phosphate regulon
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2825824 - 2826528 bp
Length : 705 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 1447208, 2993631, 3881386; Product type r : regulator

DNA sequence :
ATGAACGCGGCCCTGAAGCCGCTCGTCCTGGTCGTCGAGGACGAGGCCGACATTCTGACGCTGTTGAAGTACAACCTGGA
AAAGGAAGGCTTCCGCGTCGCCACCGCCAGCGACGGCGAGGAGGCCCTGCTGGCCGCCGGCGAACAGACGCCGCACATCG
TGCTGCTCGACTGGATGCTACCGCTGATGAGCGGGCTGGAGGTCTGCCGCCAGCTGCGCCGCAACGCCAAGACCCGCGAC
ATCCCGATCATCATGCTGACCGCCCGCGGCGAGGAAGGCGACCGGGTGCGCGGCCTGAATTCCGGCGCCGACGACTACAT
CACCAAGCCCTTCTCCCCGACCGAGCTGGTGGCCCGCATGCGCGCGGTCCTGCGCCGCGCCTCGCCCGGCATGACGGACG
AGGTGCTGACCTTCGCCGACGTGACGATGGATCTGGCCGCCCACCGCGTACGCCGCAATGGGCGCGACGTACATCTCGGT
CCGACGGAATTCCGCCTGCTGCGCCACTTCATGCAGCATCCCGGCCGCGTCTTCTCGCGCGAACAGCTGCTCGATCTGGT
GTGGGGCCATGACGTGTACGTCGAGCCGCGCACGGTCGACGTACACATCCGCCGCCTGCGCAAGGCGATGAACGAAGAGG
AAGAACTGGATCTGATCCGCACCGTGCGGTCGGCAGGCTACGCGCTGGATACGAAGTCGATGTGA

Protein sequence :
MNAALKPLVLVVEDEADILTLLKYNLEKEGFRVATASDGEEALLAAGEQTPHIVLLDWMLPLMSGLEVCRQLRRNAKTRD
IPIIMLTARGEEGDRVRGLNSGADDYITKPFSPTELVARMRAVLRRASPGMTDEVLTFADVTMDLAAHRVRRNGRDVHLG
PTEFRLLRHFMQHPGRVFSREQLLDLVWGHDVYVEPRTVDVHIRRLRKAMNEEEELDLIRTVRSAGYALDTKSM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-29 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_005040382.1 two-component response regulator; phosphate regulon AE000516.2.gene3505. Protein 4e-38 47
phoB YP_005040382.1 two-component response regulator; phosphate regulon AE016830.1.gene1681. Protein 3e-33 43
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_010400.5986590.p0 Protein 3e-29 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_010410.6002989.p0 Protein 8e-30 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_011595.7057856.p0 Protein 8e-30 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon HE999704.1.gene2815. Protein 5e-34 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_002952.2859905.p0 Protein 8e-36 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_002758.1121668.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_009641.5332272.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_013450.8614421.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_007793.3914279.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_007622.3794472.p0 Protein 8e-36 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_002745.1124361.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_009782.5559369.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_002951.3237708.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_003923.1003749.p0 Protein 1e-35 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon AE015929.1.gene1106. Protein 3e-24 41
phoB YP_005040382.1 two-component response regulator; phosphate regulon NC_012469.1.7685629. Protein 2e-32 41
phoB YP_005040382.1 two-component response regulator; phosphate regulon CP000647.1.gene2531. Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_005040382.1 two-component response regulator; phosphate regulon VFG1386 Protein 5e-30 44
phoB YP_005040382.1 two-component response regulator; phosphate regulon VFG1390 Protein 2e-31 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon VFG1389 Protein 5e-28 42
phoB YP_005040382.1 two-component response regulator; phosphate regulon VFG1563 Protein 3e-29 41
phoB YP_005040382.1 two-component response regulator; phosphate regulon VFG1702 Protein 3e-30 41