Gene Information

Name : BYI23_B005690 (BYI23_B005690)
Accession : YP_005042063.1
Strain :
Genome accession: NC_016625
Putative virulence/resistance : Virulence
Product : two-component regulatory system, response regulator protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 674113 - 674844 bp
Length : 732 bp
Strand : +
Note : -

DNA sequence :
ATGGATCATCCGAAACGCATTCTGATCGTCGAAGACGACGTGCATATCGCCGAGGTGCTCAGCCTCAATCTGCGCGACGA
GCGCTATGAAGTCGTCCACAGCGCCGACGGCGCCGAAGGCCTGCGCCTGCTCGAACAGGGCGGCTGGGATGCGCTGATTC
TCGATCTGATGCTGCCCGGCGTCGATGGCCTCGAAATCTGCCGCCGCGCCCGCGCGATGACGCGCTATACGCCGATCATC
ATCACGAGCGCGCGATCCAGCGAGGTGCATCGCATACTCGGTCTCGAACTCGGCGCGGACGACTATCTCGCCAAGCCATT
CTCCGTGCTCGAACTCGTCGCGCGCGTGAAGGCGCTGTTGCGCCGCGTCGATGCCGTCGCGAAGGATTCGCGGCTCGATG
CGGGGCGTGTCGAAGTCGCGGGCATCGCGATCGATCCGCTCGCGCGCGAAGCATGGGTCGATGGCGCGCGCATCGAACTC
ACGCCGCGCGAATTCGATTTGCTGTATCACTTCGCGCGCCATCCCGGCAAGGTGTTCTCGCGCATGGATCTGCTCAACGC
GGTGTGGGGTTATCGGCATGAAGGTTATGAGCACACCGTGAACACGCACATCAACCGCTTGCGCGCGAAGGTGGAGAAAG
ACGCGGCCGATCCGCAGCGCATTCTGACCGTATGGGGCCACGGCTACAAGCTCGCGCCGCATGCGCCCGATGACAAGGAC
GCCGCGCCGTGA

Protein sequence :
MDHPKRILIVEDDVHIAEVLSLNLRDERYEVVHSADGAEGLRLLEQGGWDALILDLMLPGVDGLEICRRARAMTRYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDAVAKDSRLDAGRVEVAGIAIDPLAREAWVDGARIEL
TPREFDLLYHFARHPGKVFSRMDLLNAVWGYRHEGYEHTVNTHINRLRAKVEKDAADPQRILTVWGHGYKLAPHAPDDKD
AAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-69 62
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-69 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein AE000516.2.gene3505. Protein 1e-37 46
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_007622.3794948.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_003923.1003417.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_013450.8614146.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_002951.3238224.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_007793.3914065.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_002758.1121390.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_010079.5776364.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_002952.2859858.p0 Protein 1e-34 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_012469.1.7685629. Protein 5e-43 44
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein AE015929.1.gene1106. Protein 2e-29 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_002952.2859905.p0 Protein 8e-41 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_009782.5559369.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_002951.3237708.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_002758.1121668.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_009641.5332272.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_013450.8614421.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_007793.3914279.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_003923.1003749.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_007622.3794472.p0 Protein 7e-41 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein NC_002745.1124361.p0 Protein 1e-40 43
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein FJ349556.1.orf0.gene Protein 2e-36 41
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein AF155139.2.orf0.gene Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein VFG1563 Protein 1e-69 62
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein VFG1702 Protein 1e-69 62
BYI23_B005690 YP_005042063.1 two-component regulatory system, response regulator protein VFG1389 Protein 3e-31 44