Gene Information

Name : BYI23_D012050 (BYI23_D012050)
Accession : YP_005044238.1
Strain :
Genome accession: NC_016626
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1371831 - 1372508 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATTCTGATTGTCGAAGACGAGGCGAAGATGGGCCTCTATCTGAAAACGGGGCTCTCCGAGGCGGGGTACACCGT
CGATTGGGTCGAGGACGGCTTATCCGGCCAGTATCAGGCGGAAACGGAAGACTACGACTTGCTGATACTGGACGTGATGC
TGCCCGGCCAGGACGGCTGGTCAGTGTTGCAAAACCTCCGCCGCACGAAGAAGACACCCGTTCTGTTTCTGACGGCGCAT
GACGATGTCGGCGACCGGGTCAAGGGACTTGAGCTTGGCGCGGATGATTATCTGTCGAAGCCATTCGATTTCGTGGAGCT
CACTGCCCGGATAAAAGTCATTCTCCGGCGCGGTCAGCCTGGCGATTCGAACACGATTCGCGTGGCCGACCTCGAGCTCG
ATCTGACCAAGCGCAAGGCCTTCAGACAGGGCAACGCGATCTTGTTGACGGCGAAGGAATTTGCCCTGCTGTGGCTGCTC
ATGCGACGTAACGGAGAGATTCTGCCGCGCGCGACCATTGCCTCTCAGGTCTGGGACATGAACTTCAATAGCGATACCAA
CGTGGTCGATTCATCGATCAGACGCTTACGCTCGAAGGTTGACGATGCCTATGCGCCCAAGCTCATTCATACCGTTCGCG
GCATGGGATATGTGCTTGAAGTGCGAGATGAGAAATGA

Protein sequence :
MRILIVEDEAKMGLYLKTGLSEAGYTVDWVEDGLSGQYQAETEDYDLLILDVMLPGQDGWSVLQNLRRTKKTPVLFLTAH
DDVGDRVKGLELGADDYLSKPFDFVELTARIKVILRRGQPGDSNTIRVADLELDLTKRKAFRQGNAILLTAKEFALLWLL
MRRNGEILPRATIASQVWDMNFNSDTNVVDSSIRRLRSKVDDAYAPKLIHTVRGMGYVLEVRDEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-54 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-53 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator BAC0197 Protein 3e-87 79
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator BAC0083 Protein 4e-63 61
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator BAC0638 Protein 7e-58 61
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator BAC0125 Protein 3e-65 61
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-61 58
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-60 56
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-55 53
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 5e-34 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 9e-33 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 1e-32 42
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-54 55
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-35 43
BYI23_D012050 YP_005044238.1 two component heavy metal response transcriptional regulator VFG1389 Protein 9e-31 43