Gene Information

Name : merR (BYI23_D009490)
Accession : YP_005043982.1
Strain :
Genome accession: NC_016626
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1095939 - 1096370 bp
Length : 432 bp
Strand : +
Note : -

DNA sequence :
ATGAGAATCGGGGAACTCGCGAAACTGGCGAACTGCACGACCGAGACCATCCGTTTCTACGAGAAGGAAGGGCTGCTGGC
TCCGCCGGAGCGAAACGGCGCGAACTATCGCAGTTACACCGCAAGCCACGTCGACCGGCTTCGTTTCATCCGGAATTGCC
GCGCGCTCGACATGACGCACGACGAAGTGCGGGCGCTGCTGGTCGCATCCGACGACCCGTCCGGCACTTGCGAGAGCGTG
AACGCGCTCGTGGACGATCACATCGTGCACGTGGATGAGCGGATCGCCGAACTCACGCATCTGCGCCAGCAACTGACGTC
GCTCAGGCAGCGATGCGGCGGCGGCGCGGCCGTCGAGCAGTGTGGCATCGTGCAGGGCCTGACATCGATGGAAACGATCG
CGCCGAAGCCGCGCACGACTCATCTGGGCTGA

Protein sequence :
MRIGELAKLANCTTETIRFYEKEGLLAPPERNGANYRSYTASHVDRLRFIRNCRALDMTHDEVRALLVASDDPSGTCESV
NALVDDHIVHVDERIAELTHLRQQLTSLRQRCGGGAAVEQCGIVQGLTSMETIAPKPRTTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 4e-31 51
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-31 51
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-31 51
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-31 51
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 9e-31 50
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 6e-31 50
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 6e-31 50
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 1e-29 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_005043982.1 MerR family transcriptional regulator BAC0301 Protein 3e-29 53
merR YP_005043982.1 MerR family transcriptional regulator BAC0058 Protein 2e-36 52