Gene Information

Name : NIES39_K03840 (NIES39_K03840)
Accession : YP_005070568.1
Strain : Arthrospira platensis NIES-39
Genome accession: NC_016640
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4261939 - 4262670 bp
Length : 732 bp
Strand : +
Note : -

DNA sequence :
TTGGAAAACCATAAGGAAAGAATTTTAGTTGTCGATGACGAGGCCAGTATCCGCCGGATTTTGGAAACTCGCCTTTCCAT
GATCGGTTACGATGTAGTAACTGCCGCCGACGGGGAGGAGGCTTTAGAAACCTTCCGCCTGACAGAACCTGACCTCGTGG
TTTTGGATGTGATGATGCCTAAACTAGATGGCTACGGAGTTTGTCAGGAATTAAGGAAGGAGTCTGACATCCCCATTATT
ATGCTCACCGCCTTGGGGGATGTCGCCGATCGCATCACCGGGTTAGAATTAGGCGCTGATGATTATGTCGTCAAACCCTT
TTCACCCAAGGAACTAGAGGCCCGTATCCGTTCCGTCCTGCGCCGCATTGATAAAAATGGCGCTTCTGGAATTCCCAGTT
CTGGAGTTATCCAAATTGCCAGTATTAGGATTGACACCAACAAGCGACAGGTTTACAAAGGTGATGAACGCATCCGCTTA
ACCGGGATGGAGTTTAGCCTATTGGAACTCTTGGTCAGTCGGTCAGGAGAACCCTTTTCCCGATCCGAAATTCTCCAGGA
AGTTTGGGGATATACTCCCGAACGCCATGTTGATACTCGCGTCGTCGATGTGCATATTTCCCGGCTCAGAGCTAAGTTAG
AAGATGATCCTAGCAACCCAGAACTGATTTTGACCGCTCGCGGTACTGGCTATTTATTCCAGCGCATTATTGATCCTTCA
GAAGTGGGTTGA

Protein sequence :
MENHKERILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRLTEPDLVVLDVMMPKLDGYGVCQELRKESDIPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRIDKNGASGIPSSGVIQIASIRIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRIIDPS
EVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NIES39_K03840 YP_005070568.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-46 50
NIES39_K03840 YP_005070568.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-46 49
NIES39_K03840 YP_005070568.1 two-component response regulator BAC0125 Protein 1e-38 47
NIES39_K03840 YP_005070568.1 two-component response regulator AE000516.2.gene3505. Protein 3e-43 47
NIES39_K03840 YP_005070568.1 two-component response regulator NC_012469.1.7685629. Protein 2e-42 46
NIES39_K03840 YP_005070568.1 two-component response regulator HE999704.1.gene2815. Protein 1e-40 45
NIES39_K03840 YP_005070568.1 two-component response regulator BAC0083 Protein 7e-36 43
NIES39_K03840 YP_005070568.1 two-component response regulator BAC0638 Protein 5e-29 43
NIES39_K03840 YP_005070568.1 two-component response regulator BAC0197 Protein 1e-33 43
NIES39_K03840 YP_005070568.1 two-component response regulator CP000034.1.gene3671. Protein 6e-38 43
NIES39_K03840 YP_005070568.1 two-component response regulator CP000675.2.gene1535. Protein 2e-37 42
NIES39_K03840 YP_005070568.1 two-component response regulator BAC0308 Protein 2e-35 42
NIES39_K03840 YP_005070568.1 two-component response regulator CP001918.1.gene5135. Protein 2e-25 42
NIES39_K03840 YP_005070568.1 two-component response regulator NC_010079.5776364.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_002952.2859858.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_007622.3794948.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_003923.1003417.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_013450.8614146.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_002951.3238224.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_007793.3914065.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_002758.1121390.p0 Protein 9e-36 41
NIES39_K03840 YP_005070568.1 two-component response regulator HE999704.1.gene1528. Protein 1e-30 41
NIES39_K03840 YP_005070568.1 two-component response regulator NC_012469.1.7686381. Protein 7e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NIES39_K03840 YP_005070568.1 two-component response regulator VFG1390 Protein 3e-39 44
NIES39_K03840 YP_005070568.1 two-component response regulator VFG0596 Protein 2e-30 43
NIES39_K03840 YP_005070568.1 two-component response regulator VFG1389 Protein 2e-32 42
NIES39_K03840 YP_005070568.1 two-component response regulator VFG1386 Protein 9e-36 41