Name : BCN_0758 (BCN_0758) Accession : YP_005103291.1 Strain : Bacillus cereus NC7401 Genome accession: NC_016771 Putative virulence/resistance : Resistance Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 835900 - 836163 bp Length : 264 bp Strand : + Note : similar to gp:AE017000_150 [Bacillus cereus ATCC 14579], percent identity 100 in 87 aa, BLASTP E(): 3e-42 DNA sequence : ATGGAATATAATCAAGATATGAAAAATAGATTGAAACGTATTGAAGGGCAAGTTCGTGGTGTGCTTCGTATGATGGAAGA AGGAAAAGATTGCCGAGAGGTTATTACACAGTTAACGGCATCTCGTTCTGCACTTGATCGTACAATTGGACTTGTTGTTG GAACGAATTTAGAGCAATGCTTGCGTGAACAGTTTGAAAGTGGTAATGGTTCAAATGAAGAGTTAATTAAAGAAGCTGTT CAATTACTTGTAAAAAGCCGATAA Protein sequence : MEYNQDMKNRLKRIEGQVRGVLRMMEEGKDCREVITQLTASRSALDRTIGLVVGTNLEQCLREQFESGNGSNEELIKEAV QLLVKSR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SA0045 | NP_373285.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
unnamed | BAA82170.2 | - | Not tested | Type-II SCCmec | Protein | 1e-19 | 50 |
SERP2514 | YP_190056.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
unnamed | BAC57484.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 3e-19 | 50 |
unnamed | BAA82210.2 | - | Not tested | Type-II SCCmec | Protein | 3e-19 | 50 |
SAV0048 | NP_370572.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
unnamed | BAA86632.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 6e-20 | 50 |
SAR0047 | YP_039520.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
unnamed | BAB47614.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 3e-19 | 50 |
SAPIG0063 | YP_005732873.1 | conserved protein YrkD | Not tested | Type-V SCCmec | Protein | 2e-18 | 48 |
SACOL0048 | YP_184958.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-18 | 48 |
unnamed | BAB83476.1 | - | Not tested | SCC 12263 | Protein | 3e-16 | 47 |
unnamed | BAA94324.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-16 | 46 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
BCN_0758 | YP_005103291.1 | hypothetical protein | BAC0333 | Protein | 1e-09 | 41 |