Gene Information

Name : BF638R_2299 (BF638R_2299)
Accession : YP_005111354.1
Strain : Bacteroides fragilis 638R
Genome accession: NC_016776
Putative virulence/resistance : Virulence
Product : putative two component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2692808 - 2693482 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGGCTAAGATATTATTGGTAGAAGATGAAGTGAATATAGCTTCGTTTATAGAACGGGGTTTGAAGGAGTTTGGACATTC
TGTGTCGGTGGCTAATGACGGTGATGCCGGATGGGAATTCATCCGGCAAGAAGCATTCGACCTGTTGATCCTGGATATTA
TCATGCCTAAGATGAACGGTCTGGAGCTATGCCGGCTTTATCGTCAGCAATACGGTTATCTCACCCCGGTTATAATGTTG
ACTGCATTGGGCACCACGGAGGATATCGTGAAAGGGCTCGATTCGGGGGCGGATGACTATTTGGTGAAACCATTCAGCTT
TCAGGAACTGGAGGCGCGCATCAAGGCCATCCTGCGCAGAGGGCGGGAAGACTCTGTCCAGCAGCTGGTATGTGATGATC
TGGTGCTTAACTGCAACACCCGCCGTGCCAGACGCAAGGAGGTGGAGATAGAACTCACTGTTAAGGAGTACCGCTTGCTG
GAGTATTTCATGACCCATCAAGGCATGGTGCTTTCGCGCCTGACATTATTGAAAGATGTATGGGATAAGAATTTCGATAC
GAATACCAATGTGGTAGATGTTTATGTGAACTATCTTCGTGGTAAAATAGATAAGGAGCATGACAAGAAATTGATTCATA
CGGTGGTAGGTTCGGGATATATCATGTATGCTTAA

Protein sequence :
MAKILLVEDEVNIASFIERGLKEFGHSVSVANDGDAGWEFIRQEAFDLLILDIIMPKMNGLELCRLYRQQYGYLTPVIML
TALGTTEDIVKGLDSGADDYLVKPFSFQELEARIKAILRRGREDSVQQLVCDDLVLNCNTRRARRKEVEIELTVKEYRLL
EYFMTHQGMVLSRLTLLKDVWDKNFDTNTNVVDVYVNYLRGKIDKEHDKKLIHTVVGSGYIMYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BF638R_2299 YP_005111354.1 putative two component system response regulator HE999704.1.gene1528. Protein 1e-26 47
BF638R_2299 YP_005111354.1 putative two component system response regulator BAC0111 Protein 6e-39 46
BF638R_2299 YP_005111354.1 putative two component system response regulator BAC0083 Protein 5e-31 46
BF638R_2299 YP_005111354.1 putative two component system response regulator BAC0125 Protein 3e-33 45
BF638R_2299 YP_005111354.1 putative two component system response regulator BAC0347 Protein 6e-35 45
BF638R_2299 YP_005111354.1 putative two component system response regulator BAC0197 Protein 1e-30 44
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_010079.5776364.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_002952.2859858.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator AE015929.1.gene1106. Protein 5e-24 43
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_007622.3794948.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_003923.1003417.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_013450.8614146.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_002951.3238224.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_007793.3914065.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator NC_002758.1121390.p0 Protein 3e-27 43
BF638R_2299 YP_005111354.1 putative two component system response regulator BAC0638 Protein 6e-25 43
BF638R_2299 YP_005111354.1 putative two component system response regulator BAC0308 Protein 2e-30 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BF638R_2299 YP_005111354.1 putative two component system response regulator VFG0596 Protein 7e-27 42