Gene Information

Name : fliQ (BACAU_1591)
Accession : YP_005130320.1
Strain : Bacillus amyloliquefaciens CAU B946
Genome accession: NC_016784
Putative virulence/resistance : Virulence
Product : Flagellar biosynthetic protein fliQ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1672822 - 1673091 bp
Length : 270 bp
Strand : +
Note : -

DNA sequence :
GTGAGTTCAGAATTTGTAATTTCCATGGCGGAAAAAGCCGTATATGTAACACTAATGATCAGCGGGCCGCTGCTTGCGAT
CGCGCTGATCGTCGGTTTGCTCGTCAGTATCTTTCAAGCGACAACTCAAATCCAGGAACAGACGCTTGCGTTCATTCCGA
AAATCGTGGCGGTGATGCTTGGACTGATCTTTTTCGGTCCTTGGATGCTGTCGACGATTCTTTCGTTCACAACTGATCTG
TTCTCTCATCTGAACCGATTTGCAGGGTAG

Protein sequence :
MSSEFVISMAEKAVYVTLMISGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVMLGLIFFGPWMLSTILSFTTDL
FSHLNRFAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ysaS AAS66847.1 YsaS Not tested SSR-1 Protein 0.012 42
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 3e-04 42
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 3e-04 42
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 3e-04 42
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 3e-04 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_005130320.1 Flagellar biosynthetic protein fliQ VFG2495 Protein 5e-09 44
fliQ YP_005130320.1 Flagellar biosynthetic protein fliQ VFG2015 Protein 5e-08 44
fliQ YP_005130320.1 Flagellar biosynthetic protein fliQ VFG0550 Protein 8e-05 42
fliQ YP_005130320.1 Flagellar biosynthetic protein fliQ VFG0395 Protein 0.004 41