Gene Information

Name : mtrA (CDC7B_0648)
Accession : YP_005162099.1
Strain : Corynebacterium diphtheriae C7 (beta)
Genome accession: NC_016801
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 650995 - 651672 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGGCACCGAAAATTTTGGTTGTCGACGATGATCCTGCGATTTCAGAGATGCTGACCATCGTGCTGGAGGCCGAGGGATT
TGAGCCGGTCGCGGTCACTGATGGGGCAGTAGCAGTTGATGCCTTTAGGACAGAATCGCCTGATCTAGTCCTACTCGATT
TGATGCTGCCTGGTATGAACGGCATCGACATTTGTAGGATAATCCGGCAGGAATCGGCAGTTCCTATCGTCATGCTCACG
GCGAAAACCGACACCGTGGACGTAGTCCTTGGTTTGGAATCGGGTGCAGATGACTACATCAACAAGCCGTTTAAGCCGAA
AGAACTCATCGCTCGACTACGTGCACGCTTGCGTCGTACAGAGGACTCTCCGTCCGAAACCATTGAGATCGGGGATCTTA
CGATCGACGTCCTAGGCCACGAAGTCACTCGAGGAGATGAGGTAATTCAACTCACTCCTTTAGAGTTTGATTTGCTGCTT
GAGCTTGCAAGCAAACCAGGGCAGGTGTTCACACGTGAGGAACTTCTGCAAAAAGTTTGGGGCTATCGCAATGCCTCAGA
CACGAGACTGGTGAATGTCCATGTGCAGCGACTGCGCTCAAAGATCGAGAAAGACCCAGAAAACCCGCACATCGTGTTAA
CAGTGCGCGGAGTGGGGTATAAGACAGGGCAGGAGTAG

Protein sequence :
MAPKILVVDDDPAISEMLTIVLEAEGFEPVAVTDGAVAVDAFRTESPDLVLLDLMLPGMNGIDICRIIRQESAVPIVMLT
AKTDTVDVVLGLESGADDYINKPFKPKELIARLRARLRRTEDSPSETIEIGDLTIDVLGHEVTRGDEVIQLTPLEFDLLL
ELASKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRSKIEKDPENPHIVLTVRGVGYKTGQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-30 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005162099.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-62 71
mtrA YP_005162099.1 two-component system response regulator NC_002952.2859905.p0 Protein 6e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_002758.1121668.p0 Protein 5e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_009641.5332272.p0 Protein 5e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_013450.8614421.p0 Protein 5e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_007793.3914279.p0 Protein 5e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_002745.1124361.p0 Protein 5e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_009782.5559369.p0 Protein 5e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_002951.3237708.p0 Protein 5e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_007622.3794472.p0 Protein 6e-37 47
mtrA YP_005162099.1 two-component system response regulator NC_003923.1003749.p0 Protein 4e-37 47
mtrA YP_005162099.1 two-component system response regulator HE999704.1.gene2815. Protein 3e-35 47
mtrA YP_005162099.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-35 47
mtrA YP_005162099.1 two-component system response regulator NC_012469.1.7686381. Protein 8e-33 44
mtrA YP_005162099.1 two-component system response regulator CP000675.2.gene1535. Protein 8e-27 42
mtrA YP_005162099.1 two-component system response regulator AF155139.2.orf0.gene Protein 2e-27 42
mtrA YP_005162099.1 two-component system response regulator BAC0125 Protein 4e-25 42
mtrA YP_005162099.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-27 41
mtrA YP_005162099.1 two-component system response regulator BAC0111 Protein 1e-20 41
mtrA YP_005162099.1 two-component system response regulator AE016830.1.gene1681. Protein 8e-33 41
mtrA YP_005162099.1 two-component system response regulator BAC0083 Protein 7e-21 41
mtrA YP_005162099.1 two-component system response regulator BAC0197 Protein 7e-22 41
mtrA YP_005162099.1 two-component system response regulator CP000034.1.gene3671. Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005162099.1 two-component system response regulator VFG1563 Protein 6e-31 44
mtrA YP_005162099.1 two-component system response regulator VFG1702 Protein 3e-31 44
mtrA YP_005162099.1 two-component system response regulator VFG1390 Protein 2e-26 43
mtrA YP_005162099.1 two-component system response regulator VFG1389 Protein 6e-19 41