Gene Information

Name : merP (SFHH103_06268)
Accession : YP_005192866.1
Strain :
Genome accession: NC_016815
Putative virulence/resistance : Resistance
Product : Copper-transporting ATPase 1 Copper pump 1; Menkes disease-associated protein
Function : -
COG functional category : -
COG ID : -
EC number : 3.6.3.4
Position : 1510711 - 1510962 bp
Length : 252 bp
Strand : -
Note : -

DNA sequence :
ATGCTTGCCCCGGCCGCCTGGGCCGGCGAGCGCACCGTCACCTTTGCCGTCGAAAACATGACCTGCGCCACGTGTCCCTA
CATCGTCAAGACCACGATGGCGGCGGTCCCTGGCGTCGCGAATGTGACGGTCTCCTTCGAGGCGAAGACGGCAACCGTGA
CCTTTGACGATGCAACGACGAACCCGGACGCGATCGCGGCCGCCAGCATGAATGCCGGTTATCCGGCCCACCCGACGCAG
CAGGGCGGCTAA

Protein sequence :
MLAPAAWAGERTVTFAVENMTCATCPYIVKTTMAAVPGVANVTVSFEAKTATVTFDDATTNPDAIAAASMNAGYPAHPTQ
QGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 1e-13 53
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-11 49
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-11 49
merP ABQ57373.1 MerP Not tested SGI1 Protein 6e-12 46
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 6e-12 46
merP AFG30122.1 MerP Not tested PAGI-2 Protein 6e-12 46
merP AGK07023.1 MerP Not tested SGI1 Protein 6e-12 46
merP AGK07081.1 MerP Not tested SGI1 Protein 6e-12 46
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 9e-12 46
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-13 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_005192866.1 Copper-transporting ATPase 1 Copper pump 1; Menkes disease-associated protein BAC0675 Protein 7e-12 50
merP YP_005192866.1 Copper-transporting ATPase 1 Copper pump 1; Menkes disease-associated protein BAC0679 Protein 5e-12 49
merP YP_005192866.1 Copper-transporting ATPase 1 Copper pump 1; Menkes disease-associated protein BAC0231 Protein 4e-12 47
merP YP_005192866.1 Copper-transporting ATPase 1 Copper pump 1; Menkes disease-associated protein BAC0678 Protein 3e-12 46
merP YP_005192866.1 Copper-transporting ATPase 1 Copper pump 1; Menkes disease-associated protein BAC0674 Protein 7e-13 44