Gene Information

Name : Rahaq2_4674 (Rahaq2_4674)
Accession : YP_005220408.1
Strain :
Genome accession: NC_016835
Putative virulence/resistance : Resistance
Product : cation/cationic drug transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 107727 - 108062 bp
Length : 336 bp
Strand : -
Note : PFAM: Small Multidrug Resistance protein

DNA sequence :
ATGTTCAAAATATATCTGATCCTCGCTGTTTCTATCTGCGCGGAAACACTGGCGACGACCATGATGAAAGCGTCTAATGG
ATTCACCCGGTTAATTCCGAGCGTCATTGTGGTTGTCGGTTATGCCATATCGTTTTATGGCCTTTCTCAGGTTGTTAAAG
TGATGCATATCGGCATCGCCTACGCTATCTGGGCAGGAATGGGGATTTTCCTTGTTTCAGCCATGTCATTTTTCATCTAC
AAACAGCGGCTTGATACCCCGGCGCTGATTGGCATGGGCTGCATCGCTCTCGGCATTATGATCATCCAGCTTTATTCTAA
ATCTGTGTCGCATTAA

Protein sequence :
MFKIYLILAVSICAETLATTMMKASNGFTRLIPSVIVVVGYAISFYGLSQVVKVMHIGIAYAIWAGMGIFLVSAMSFFIY
KQRLDTPALIGMGCIALGIMIIQLYSKSVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-18 43
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-18 43
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-18 43
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-18 43
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 43
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-18 43
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 43
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-18 43
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 43
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 43
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-18 43
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-18 43
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 43
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-18 43
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 43
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 43
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-18 43
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 43
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-18 43
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-18 43
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 5e-14 41
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-13 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter CP004022.1.gene1549. Protein 1e-24 60
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter BAC0377 Protein 7e-26 57
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter BAC0002 Protein 2e-19 54
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter NC_010410.6003348.p0 Protein 2e-19 54
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter BAC0324 Protein 2e-20 51
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter BAC0150 Protein 3e-16 50
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter NC_002695.1.913273.p Protein 5e-16 48
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter CP001138.1.gene1489. Protein 3e-17 44
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter BAC0323 Protein 2e-18 43
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter BAC0322 Protein 2e-21 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter VFG1586 Protein 2e-14 41
Rahaq2_4674 YP_005220408.1 cation/cationic drug transporter VFG1587 Protein 9e-14 41