Gene Information

Name : STMDT12_C15350 (STMDT12_C15350)
Accession : YP_005247231.1
Strain : Salmonella enterica T000240
Genome accession: NC_016860
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional activator MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1594784 - 1595167 bp
Length : 384 bp
Strand : -
Note : COG2207 AraC-type DNA-binding domain-containing proteins

DNA sequence :
ATGTCCAGACGCAACACTGACGCTATTACTATTCATAGCATTTTGGACTGGATCGAGGATAACCTGGAGTCGCCGCTCTC
ACTGGAAAAAGTGTCTGAGCGTTCAGGATATTCCAAATGGCACCTGCAACGGATGTTTAAAAAAGAGACCGGTCATTCAT
TAGGCCAATACATCCGCAGCCGTAAAATGACGGAAATCGCGCAAAAATTAAAAGAGAGCAACGAGCCCATTCTCTATCTG
GCGGAACGCTATGGCTTTGAGTCACAGCAAACATTGACCCGGACGTTCAAAAACTATTTTGATGTGCCGCCACACAAATA
CCGGATCACCAATATGCATGGCGAATCACGGTATATGCTGCCGCTGAACCATGGCAACTACTAG

Protein sequence :
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRITNMHGESRYMLPLNHGNY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-21 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-21 43
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP001138.1.gene1637. Protein 7e-57 100
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA NC_002695.1.917339.p Protein 2e-53 96
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA BAC0560 Protein 2e-53 96
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP000034.1.gene1596. Protein 3e-53 96
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP001918.1.gene2033. Protein 3e-52 95
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP000647.1.gene1624. Protein 1e-51 93
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA NC_010558.1.6276025. Protein 3e-21 43
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP001138.1.gene612.p Protein 7e-23 42
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA BAC0371 Protein 2e-19 42
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP001138.1.gene4488. Protein 5e-20 42
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA NC_002695.1.914293.p Protein 2e-19 42
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP000034.1.gene4505. Protein 3e-19 42
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP001918.1.gene327.p Protein 4e-20 42
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA CP000647.1.gene4499. Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA VFG1038 Protein 2e-21 43
STMDT12_C15350 YP_005247231.1 DNA-binding transcriptional activator MarA VFG0585 Protein 5e-20 42