Gene Information

Name : STMDT12_C38940 (STMDT12_C38940)
Accession : YP_005249590.1
Strain : Salmonella enterica T000240
Genome accession: NC_016860
Putative virulence/resistance : Unknown
Product : putative transposase OrfA protein of insertion sequence IS629
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4049282 - 4049590 bp
Length : 309 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGATAAGTTTATCACCACCGACTATTTGCAACAGTGCCCTGGAAAGTCAGGGCGAATATGACTCACAATGGGCGGCAAT
TTGTTCCATTGCTCCAAAGACTGGCTGTACGCCGGAGACTCTGCGTGTCTGGGTTCGCCAGTATGAGCGGGATACCGGGG
GCGGAGATGGAGGGCTCACCAGTGCTGAACGTCAGCGTCTGAAAGAGCTGGAACGTGAAAATCGTGAACTGCGCCGCAGC
AACAATATCCTTCGCCAGGCTTCCGCTTATTTTGCGAAGGCGGAGTTCGACCGCCTCTGGAAAAAGTGA

Protein sequence :
MISLSPPTICNSALESQGEYDSQWAAICSIAPKTGCTPETLRVWVRQYERDTGGGDGGLTSAERQRLKELERENRELRRS
NNILRQASAYFAKAEFDRLWKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 2e-18 98
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-18 97
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-18 97
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-19 95
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-19 95
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 3e-19 95
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 8e-23 94
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 8e-23 94
unnamed AAF09023.1 unknown Not tested SHI-O Protein 2e-17 94
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 8e-23 94
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 2e-17 94
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 8e-23 94
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 3e-17 93
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-16 93
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-16 93
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 1e-22 93
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 2e-16 93
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 2e-16 93
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 1e-22 93
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 2e-16 93
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 2e-16 93
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 1e-22 93
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 5e-17 93
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-17 93
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 1e-22 93
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-17 93
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 2e-22 93
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-17 93
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 7e-17 93
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 7e-17 93

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMDT12_C38940 YP_005249590.1 putative transposase OrfA protein of insertion sequence IS629 VFG1603 Protein 8e-19 98
STMDT12_C38940 YP_005249590.1 putative transposase OrfA protein of insertion sequence IS629 VFG0606 Protein 8e-18 93
STMDT12_C38940 YP_005249590.1 putative transposase OrfA protein of insertion sequence IS629 VFG0643 Protein 2e-17 93
STMDT12_C38940 YP_005249590.1 putative transposase OrfA protein of insertion sequence IS629 VFG1717 Protein 6e-17 93