Gene Information

Name : Sulac_1071 (Sulac_1071)
Accession : YP_005256243.1
Strain : Sulfobacillus acidophilus DSM 10332
Genome accession: NC_016884
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1077138 - 1077812 bp
Length : 675 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: bbe:BBR47_1107

DNA sequence :
ATGAACGCCAAGGCACGGATCCTGGTCGTCGACGACGAAGAAAGTATCCGAGACCTGTTAGATATGGGGCTTCGGCACCG
GGGCTTTGAGGTATTGACCTGCCCCGACGCCGAGACCGCATTAGCTCAGGTGGGATCTTTTGATCCGCATGCCGCCATCA
TCGACGTCATGATGCCGGGCGAGGACGGCTTCCAACTGAGTCGCCGTCTACGGCAAAATCCCGACCTTTATATCATCATG
TTGACGGCACGCGACGCCGTATCCGACCGAGTGCACGGCCTCGAAGGCGGAGCCGACGATTATCTGATCAAACCGTTTGA
TTTTGATGAGTTGGTGGCACGTATCCATGCCGGTCTCCGACGTATTCGCAAACACGAATCGACGACCTGGCAATTTGGGC
CGGTTACGATGGATGATGCCAGCCATCGTGTGTCGGTAGAGGGGAACCCGGTCAATTTGACCGCCAAAGAATATGAGTTA
TTACGGTACCTAATGCTCAATCCCGGTCACGTCTTGTCCAAGACGCAGATTTTGCAACATGTCTGGGGTTATGACTACCT
AGGTGACGACAACTTGGTGGAAGTACACATTTCGAGCTTGCGGGACAAGCTCAACGATAAACAAAAAGCCTTGATACAAA
CGGTGCGGGGCTTTGGCTACCGATTGGGAGATTAA

Protein sequence :
MNAKARILVVDDEESIRDLLDMGLRHRGFEVLTCPDAETALAQVGSFDPHAAIIDVMMPGEDGFQLSRRLRQNPDLYIIM
LTARDAVSDRVHGLEGGADDYLIKPFDFDELVARIHAGLRRIRKHESTTWQFGPVTMDDASHRVSVEGNPVNLTAKEYEL
LRYLMLNPGHVLSKTQILQHVWGYDYLGDDNLVEVHISSLRDKLNDKQKALIQTVRGFGYRLGD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-36 44
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-36 43
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-36 43
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-36 43
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-33 42
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-36 42
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-26 42
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-31 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-34 41
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 8e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator VFG1386 Protein 5e-45 45
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-37 43
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-34 43
Sulac_1071 YP_005256243.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-34 41